KEGG   Cyclobacterium marinum: Cycma_0702Help
Entry
Cycma_0702        CDS       T01592                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00010  Glycolysis / Gluconeogenesis
cmr00020  Citrate cycle (TCA cycle)
cmr00620  Pyruvate metabolism
cmr01100  Metabolic pathways
cmr01110  Biosynthesis of secondary metabolites
cmr01120  Microbial metabolism in diverse environments
cmr01130  Biosynthesis of antibiotics
cmr01200  Carbon metabolism
Module
cmr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cycma_0702
   00020 Citrate cycle (TCA cycle)
    Cycma_0702
   00620 Pyruvate metabolism
    Cycma_0702
Enzymes [BR:cmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cycma_0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 GCV_H QRPTase_N Na_trans_cytopl PYNP_C Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AEL24476
UniProt: G0J0R4
Position
complement(794639..796291)
Genome map
AA seq 550 aa AA seqDB search
MAEIIRMPKMSDTMEEGVIAQWLKKVGDKVKPGDILAEVETDKATMELESYDEGTLLHIG
VKEKDAVPVNGVIAILGEEGENIDDLLKDVDSGGSSESASTETKEDAAEEKSEDKAKETT
SEIDVSGIAATVITMPKMSDTMQEGTIASWLKKEGDEVKSGDVLAEVETDKATMELESYD
DGTLLYIGVSEGESVEVNGVIAIIGEKDADYKTLLKAHQQKSSGAEEVKAEPVKEEKSAP
KAEEGKPSNAVADSSTSTTDKGRIKASPLAKKMASEKGIDISLVKGTGDNGRIIKKDIEN
FDPSKVTAASSSSSDAPSGVAIGQESYTDVKVSQMRKVIAKRLAESKFTAPHFYLTMEIN
MDKAIEARKSMNEVAPVKISFNDMVIKAAAASLKQHPAVNSAWMEDKIRYNDHVHIGMAV
AIDDGLLVPVIRFTDSKSLSQISQEAKSLAGKAKNKELQPKDWEGNTFTVSNLGMFGIEE
FTAIINPPDACILAIGGIKQTPIVKDGEIKIGNVMKVTLSCDHRVVDGAVGSAFLKTLKS
LLEDPVRLLI
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaataatacgaatgcccaaaatgagcgacaccatggaagaaggggtgattgct
caatggttgaaaaaggtaggtgataaagtaaaacccggagatattctggcagaagtggaa
actgataaagcgaccatggaactagaatcatacgatgagggtaccttgcttcacattggc
gtaaaggaaaaagatgctgttcctgtcaatggtgtaattgccattctgggtgaagaaggt
gagaatatagacgatctcttgaaagatgtggactcaggaggaagctcggaaagcgcctct
actgaaactaaggaagatgcagctgaagaaaagtctgaagataaagctaaagaaactact
tctgaaatagatgtgtcaggaattgctgcaacggtaattaccatgcctaagatgagcgac
accatgcaagaaggtaccatcgctagttggttgaaaaaggagggagatgaagtcaagtca
ggtgatgtcttggccgaagtggaaactgataaagcaaccatggaactggagtcgtatgac
gatggaaccctactatatattggcgtgtctgagggtgagtccgttgaagtaaatggagtc
attgccattattggtgaaaaagatgccgattataaaaccttacttaaagcccatcaacaa
aaatcatcgggtgctgaagaagtaaaagctgaaccggttaaagaggagaaatctgctcca
aaagctgaggaaggtaagccgtcaaatgcagtggctgattcttcaaccagtacaacggac
aaaggaagaataaaagcctctcctcttgccaagaaaatggcaagtgaaaaaggtattgat
atctcacttgtgaaaggtacaggtgataatggcagaataattaaaaaggacattgagaat
tttgatccttcaaaagttactgctgccagttcatcaagtagtgatgcaccaagtggtgtt
gctataggtcaagagtcctataccgatgttaaagtctctcaaatgaggaaggtgattgcc
aagcgactcgccgaaagtaaatttactgctcctcatttttatttgaccatggaaatcaac
atggacaaagccattgaggctagaaaaagcatgaatgaagtggctcctgtgaaaatatct
tttaatgatatggttattaaagccgccgctgcctcgcttaaacaacacccggcagttaac
tctgcttggatggaggacaaaatcagatacaatgaccatgtacatattggtatggctgta
gctattgatgatggtttattggttcctgtaattagatttacagatagtaagtccctatcg
cagatttcacaagaagccaaatctttggctggaaaagctaaaaacaaagaattgcaacca
aaagattgggaaggtaatactttcactgtgtctaatttggggatgtttggtatagaagag
tttactgctattattaacccacctgatgcatgtatcctggcaattggaggaatcaaacaa
acgccaattgtaaaagatggagaaatcaaaataggcaatgttatgaaagttaccttatct
tgtgaccacagagtggtggatggagctgtaggttcagccttccttaaaactttgaaaagt
ttattagaagatccggttaggttgttaatctga

DBGET integrated database retrieval system