KEGG   Cyclobacterium marinum: Cycma_0909Help
Entry
Cycma_0909        CDS       T01592                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cmr  Cyclobacterium marinum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cmr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1073341..1073829)
Genome map
AA seq 162 aa AA seqDB search
MHQVVLGLGGNRGDRLALLNKASQLLAQKMDLEKASSIYHTAAWGGNSHGAYLNQVLVLR
TSMKAEECLNFIQQIENQLGRKRGVKWGDRTMDIDILYFDHEIIETERLKVPHPHLTSRN
FVLVPLAEVLPEFIHPQFGKSSLELMQKCEDKLKVKVWQKEG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaggtagtattgggcttaggtggaaataggggagaccggcttgccttgctaaac
aaagcaagccaactactcgcccaaaaaatggacttggaaaaggcgtcttcaatctatcat
acagccgcttggggagggaattcgcatggggcctatttaaatcaggtgcttgttttgaga
acgtctatgaaggcggaggaatgcttgaattttatccaacaaattgaaaatcaattgggc
aggaagcgtggggtgaagtggggagatagaaccatggatattgacattctgtattttgac
catgaaatcattgagactgaaaggctgaaagtgccacatcctcatttgacctcaagaaac
tttgtgctcgttcctttggcagaagtattaccggaatttattcatcctcagtttgggaag
tcttccttagaattaatgcaaaagtgtgaagataaattaaaagtgaaggtttggcaaaag
gaggggtag

DBGET integrated database retrieval system