KEGG   Cyclobacterium marinum: Cycma_0937Help
Entry
Cycma_0937        CDS       T01592                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cmr  Cyclobacterium marinum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cycma_0937
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cycma_0937
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cycma_0937
Enzymes [BR:cmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cycma_0937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1103811..1105181)
Genome map
AA seq 456 aa AA seqDB search
MKNRKINLEESEIPENWYNIIADMPNKPLPPLNPGTMQPLGPEALAPLFPEALIKQEVTT
DKWVTIPDEVRNMYSIWRPTPMYRAYGLEKALDTPAKIYYKYEGVSPSGSHKPNTAIPQA
YYNKQEGVKRITTETGAGQWGSALSFACQHFGLECDVYMVRLSYKDKPYRKMMMNTWGAN
VYPSPSDRTEAGRKILAEFPDSPGSLGIAISEAVEMAATRDDTKYALGSVLNHVKLHQTI
IGLEAIKQLEKAGSDMPDIVIAPFGGGSNFAGLSFPFLRLNLEEGNNIRCIASEPSSCPK
LTRGVFRYDFGDTAGMTPLLPMYTLGHDFIPAPIHAGGLRYHGAGVIVSQLLKDKLIEAQ
SHDNLEIFDAGVLFARSEGIIPAPEANHGIATAIKEAKKCKEEGVSKTILFNLCGHGNFD
MKAYDDYFSGKIKSHELGQEEIDQSIAKLNTPEIPA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacagaaaaataaacttagaagaaagcgagattccagaaaattggtacaatatc
atagctgatatgcccaataaaccattgccacctttaaatcccggcaccatgcagccttta
gggccggaagcacttgcgcctctatttcctgaagctttgattaaacaagaagtaactact
gataagtgggttacaattccggatgaagtaaggaatatgtattctatttggagacctaca
cccatgtatcgtgcgtatggcttggaaaaagcgctagatacaccggcaaaaatttattat
aaatatgaaggggtcagtccttctggttcccataagcccaatacagctattcctcaggct
tattataacaaacaagaaggggtcaagcgaatcaccacagaaaccggcgcaggacagtgg
ggaagtgctttgagttttgcttgtcagcatttcggacttgaatgtgatgtatatatggta
aggctttcttacaaagacaagccttatagaaaaatgatgatgaatacctggggcgctaat
gtttacccatctccttcagacaggactgaagcaggtagaaagattctggcagagttccct
gactcgccgggaagtcttgggatagctatttccgaagccgtagaaatggccgctactaga
gatgataccaaatatgccttggggagtgtcttaaatcatgtgaaattacatcaaaccatt
ataggtttagaggcgattaaacaacttgaaaaagcaggtagcgatatgcctgacattgta
attgcaccatttggtggcggatcgaattttgcagggctttcttttccatttttgcgatta
aatctagaagaaggaaataatattcggtgcattgccagtgaaccctcttcttgtccaaaa
cttacccgtggggtatttaggtatgattttggtgatacagccggaatgactccactattg
ccaatgtatacgctagggcatgactttataccggctccaattcacgcaggagggctgcgg
tatcacggtgccggggtgattgtgagtcagttgctaaaagataaattgattgaagcccaa
tctcatgataaccttgaaatcttcgatgcaggagtgctttttgccaggtcagaaggaatt
attcctgctccggaagccaatcacggcattgccacagccattaaagaggctaagaagtgc
aaggaggaaggggtttcaaaaactattttgtttaatctctgtgggcatggaaattttgac
atgaaggcctatgacgattatttttccggtaaaataaaaagtcatgagctaggacaagag
gagattgatcaatccattgccaaacttaatacccccgaaatccccgcttaa

DBGET integrated database retrieval system