KEGG   Cyclobacterium marinum: Cycma_0977Help
Entry
Cycma_0977        CDS       T01592                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cmr  Cyclobacterium marinum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cmr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1148795..1149496
Genome map
AA seq 233 aa AA seqDB search
MKQKETLLNSAGIDLNQAIDDIGDDHISSSHDTPLREDAFEMDDDLKMELIEKHFKEIMN
ILGMDLKDDSLKGTPKRVAKMFVKEVFSGLDPKNKPEVKLFENKYKYNEMLVEKDITFFS
HCEHHFVPIYGKAHVAYISNGSVIGLSKINRIVQYFAKRPQVQERLTVQIGNELKKALGT
DDVAVIMDADHMCVSSRGVRDTSSSTVTSFYSGKFENDNQKRTEFLKYISLSR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaagaaactttgttgaattcagcggggattgatctcaatcaagccattgac
gacataggagatgaccatatttcttcttcccatgacactccattgcgggaagatgctttt
gagatggatgatgatctgaaaatggaattgattgaaaaacattttaaagaaatcatgaat
attcttggcatggacctgaaagacgatagcttgaaaggcactccaaaaagagtagctaaa
atgtttgtgaaagaagttttttcaggactggacccaaaaaacaaaccagaggtaaaacta
tttgaaaataaatacaagtacaatgaaatgctggtagagaaagacattacctttttctcc
cactgtgaacatcattttgtacctatttatggaaaagcacatgtggcttatatttctaat
ggcagtgtaatcggattgtctaaaataaatagaattgttcaatattttgccaaaaggcct
caggttcaagaaaggcttactgtccaaattggtaatgaactaaaaaaagctttagggaca
gatgatgtagctgtaattatggacgcagaccatatgtgcgtatccagcagaggcgtacga
gacactagcagcagtactgtcacctctttttatagcgggaagtttgaaaatgacaatcaa
aaaagaaccgaattcctcaaatacatttctctatcaaggtaa

DBGET integrated database retrieval system