KEGG   Cyclobacterium marinum: Cycma_0983Help
Entry
Cycma_0983        CDS       T01592                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cmr  Cyclobacterium marinum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cycma_0983
Enzymes [BR:cmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Cycma_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1153678..1154841
Genome map
AA seq 387 aa AA seqDB search
MSTIKRVAILGSTGSIGTQALDVIQQHSDKFEVEVLTAFNNKDLLIKQALAFQPNVVVIG
NENHYLEVKEALSKHPIKVYAGDKALASVVEMETIDIVLTALVGYAGLIPTIKAIEAGKP
IALANKETLVVAGDLITKLAKKKAVNIYPVDSEHSAIFQCLVGEFHNPIEKIILTASGGP
FRGRDREYLKNVTKEQALKHPNWDMGAKITIDSASLMNKGLEVIEAKWLFGLDASQIEVI
VHPQSIVHSLVQFEDGSIKGQLGLPDMRIPIQFALSYPERVKSNFERFNFMDYPNLQFEK
PDRQTFKNLDLAFTALVRGGNAACSLNAANEIAVAAFLQDKVKFLEMSDLIEQSMEKISF
IKEPSLDDLIATDKETRIISEELISRK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaattaaacgtgtggccatcttaggctcaacaggtagtataggtacacaagct
ttagatgtgattcagcaacattctgacaaatttgaagttgaagtccttacggcttttaat
aacaaagacctattaatcaaacaggcgttagctttccaaccaaatgttgtagtcattggc
aatgaaaaccattatcttgaggttaaagaggctttgagcaaacatcctattaaggtatat
gccggagataaggcacttgcctccgtggttgagatggagacgattgatattgtgcttaca
gctttagtgggctatgcaggcttaatacctacgatcaaggccatagaagccggcaaaccc
atcgccttagccaataaagaaactttggtggtggccggagatcttatcaccaaactcgcc
aaaaagaaagctgtaaatatctacccggtagattcagaacattcggcgatctttcaatgt
ttggttggtgaatttcataatcccatcgaaaaaataatacttacagcctccggaggcccc
ttccgtggcagggatagggaatatttaaaaaatgttaccaaagaacaggcactcaaacat
cccaattgggacatgggggctaaaatcacaatcgattcagcttctttgatgaataaaggg
cttgaagttatcgaagcaaaatggctttttggattggatgcaagccagattgaggtaatt
gttcatccacaatccatagtacattctttggttcaatttgaagacggttcgatcaaaggg
caacttggactaccagacatgcgtattcctattcagtttgccttgtcatatccggaaaga
gtaaaatcaaattttgaaagatttaatttcatggattatccgaatcttcaatttgagaaa
cctgatcgacaaacattcaaaaacttggacttggccttcacggccttagtaagaggtggg
aatgctgcctgttcactgaatgctgccaatgaaatcgctgtggctgcatttttgcaggat
aaagtcaaatttcttgaaatgtcagacttgattgaacagagtatggaaaaaattagtttt
attaaagaaccaagtttggatgacttaattgcgacagacaaggaaacaagaataatttca
gaagaattaattagtagaaaataa

DBGET integrated database retrieval system