KEGG   Cyclobacterium marinum: Cycma_1100Help
Entry
Cycma_1100        CDS       T01592                                 

Definition
RpiB/LacA/LacB family sugar-phosphate isomerase
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
cmr  Cyclobacterium marinum
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:cmr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cmr01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cmr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cmr00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1293159..1293593)
Genome map
AA seq 144 aa AA seqDB search
MSEIIAIGGDHAGFTYKQKLIEVLQKKGYEVKDFGPFSEGSVDYPDFIHPLCNAITSGEM
KRGIIICGSGNGVAITANKHQGIRAAICWNEELAALSRQHNDANLISIPARFVSFELAEK
MVETFLTTAFEGGRHARRVDKIPC
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaataatcgctataggaggtgaccatgcaggattcacctataaacaaaagttg
atagaagtcctccagaaaaaaggctatgaagtaaaggactttggtcctttttctgagggg
tcagtggattatcctgattttatccatcccttgtgtaatgcaattacttcaggagaaatg
aaacgtgggataatcatctgtggcagtggcaatggagtggccattactgccaataaacac
caaggaattagagcggccatttgctggaatgaggaattggcagccctttcaaggcaacac
aatgatgcaaaccttatttctattcctgcaagatttgtaagctttgaacttgcagagaaa
atggtagagacattccttactacagcgtttgaaggaggaagacatgcccgaagagtggac
aaaattccctgctaa

DBGET integrated database retrieval system