KEGG   Cyclobacterium marinum: Cycma_1100Help
Entry
Cycma_1100        CDS       T01592                                 

Definition
RpiB/LacA/LacB family sugar-phosphate isomerase
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
cmr  Cyclobacterium marinum
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cycma_1100
   01230 Biosynthesis of amino acids
    Cycma_1100
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cycma_1100
   00051 Fructose and mannose metabolism
    Cycma_1100
Enzymes [BR:cmr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Cycma_1100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1293159..1293593)
Genome map
AA seq 144 aa AA seqDB search
MSEIIAIGGDHAGFTYKQKLIEVLQKKGYEVKDFGPFSEGSVDYPDFIHPLCNAITSGEM
KRGIIICGSGNGVAITANKHQGIRAAICWNEELAALSRQHNDANLISIPARFVSFELAEK
MVETFLTTAFEGGRHARRVDKIPC
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaataatcgctataggaggtgaccatgcaggattcacctataaacaaaagttg
atagaagtcctccagaaaaaaggctatgaagtaaaggactttggtcctttttctgagggg
tcagtggattatcctgattttatccatcccttgtgtaatgcaattacttcaggagaaatg
aaacgtgggataatcatctgtggcagtggcaatggagtggccattactgccaataaacac
caaggaattagagcggccatttgctggaatgaggaattggcagccctttcaaggcaacac
aatgatgcaaaccttatttctattcctgcaagatttgtaagctttgaacttgcagagaaa
atggtagagacattccttactacagcgtttgaaggaggaagacatgcccgaagagtggac
aaaattccctgctaa

DBGET integrated database retrieval system