KEGG   Cyclobacterium marinum: Cycma_1179Help
Entry
Cycma_1179        CDS       T01592                                 

Definition
metallophosphoesterase
Organism
cmr  Cyclobacterium marinum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1388004..1389581
Genome map
AA seq 525 aa AA seqDB search
MKKLICFCWALSLSFSLLAQNTVTGYIYEDSNQNGKKERREKGIPEVAVSNGKEVVLTDK
KGKYSLPIGIDNIIFVIKPSGYKVPVGENQLPEFYYIHKPEGSPELQYKGSEPTGKLPKS
VNFALHKTEEPDNFTAMIFGDPQPYNKTELDQFAKGVVDKAKEESNISFGISLGDLAGDD
LDLHPPYVEILKQTRWHWYNVMGNHDMNYDAKIDEHSDESFERVFGPATYSFNQGNAHFI
ILDDILYPDPRDDKGYWGGFTQTQLDFIENNLKHVDKDKLIVLSFHIPFLHINENGFRNS
DRQKIFDLLKDYQNVLALSAHTHLQRHNFYTEEDGWEGSTPFHEYNAGTTSGDWYSGKIN
DDGVPISTMRDGTPKGYALLHIEGNQYKIDYQVIGAPKEHQIKIFNPKVVANNRGSGSGI
FANFYMGDKNDKVEYRIDNGPWKKMNWIEAPDPSYVASVMEWDLMDKLEPGRRPSNPVNV
THLWKGSIDTKLPVGKHTITVRATDMFGRTFTETSEYTVAEPVAY
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactaatctgcttttgttgggcactaagtctcagttttagccttctggcacaa
aacaccgtcacgggctacatctatgaagacagcaatcaaaatggtaaaaaggaacgcaga
gaaaagggcattcctgaagtggctgtcagcaacggaaaagaggtagtactgactgataaa
aaaggaaagtattctttacctataggaatcgataatatcatttttgttatcaaaccaagt
ggctataaagtgcctgttggtgaaaatcaattacctgaattttattatatccacaaacca
gaaggctctcccgaacttcaatacaagggttctgagccaaccggaaagctgccaaaatca
gtgaactttgcactccataaaaccgaagagccggataattttactgcaatgatctttggt
gatccacagccatataataaaacggaattggatcaatttgctaaaggtgtagtagacaaa
gccaaggaagaaagcaatattagttttggtattagccttggtgatttggcaggagatgac
ttggatttacaccctccttatgtggaaattttaaaacaaactagatggcactggtacaat
gtaatgggtaaccatgacatgaattatgacgctaagatagatgagcattctgacgaatcc
tttgaaagggtctttggccctgccacttattcttttaaccaaggaaatgcgcacttcatt
attttagatgatattttatatccagaccctagggatgataaaggttattggggtggattt
acacaaacccagttggactttatagaaaacaacctgaagcacgtagacaaagacaaatta
attgtactgtcttttcacattcccttcctccatatcaatgaaaatggattcaggaacagt
gaccgacaaaagatttttgatctactgaaggattaccaaaatgtattggccctatcagca
catacccatttgcaacgccataatttttatacggaagaagatggctgggaaggcagtact
ccttttcacgaatacaatgcaggcaccacttcaggtgattggtactccgggaaaataaac
gatgatggcgttcccatttcaaccatgagagatggtactcccaaaggatacgccctactt
catattgaaggaaatcaatataaaatagattatcaggtaattggagcaccaaaagaacac
caaataaagattttcaaccccaaagttgtcgccaataaccgtggttccggctcaggcatt
tttgccaacttctatatgggagacaaaaatgataaggtagagtatcgaatagacaatggc
ccttggaaaaaaatgaattggatagaggcacctgatccttcctatgtagcctccgtaatg
gaatgggacctgatggataaattagagcccggaagaagaccttccaaccctgtgaatgtt
acccacctttggaaaggaagcatagacactaaactgccggtaggcaaacataccatcacc
gttagagccacagatatgtttggccggacttttactgagaccagcgaatataccgttgct
gagccggtggcttattga

  All links  
No link information was found.   
DBGET integrated database retrieval system