KEGG   Cyclobacterium marinum: Cycma_1305Help
Entry
Cycma_1305        CDS       T01592                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cmr  Cyclobacterium marinum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cycma_1305
   01230 Biosynthesis of amino acids
    Cycma_1305
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cycma_1305
   00051 Fructose and mannose metabolism
    Cycma_1305
   00562 Inositol phosphate metabolism
    Cycma_1305
Enzymes [BR:cmr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cycma_1305
Exosome [BR:cmr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cycma_1305
  Exosomal proteins of bladder cancer cells
   Cycma_1305
  Exosomal proteins of melanoma cells
   Cycma_1305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1545176..1545937
Genome map
AA seq 253 aa AA seqDB search
MRKKIVAGNWKMNCLLEEGQKLTSEIVNMIKDEPIKDVKVILNPPFVHLHGVKKLIAGVD
NIALGAQNCSDKEAGAYTGETSAAMLASFGAEYVIIGHSERRSMFNESNELLTEKTKQAL
SNGLTPIFCCGEPLEIREADTHEDYVKAQLTESLFGFSEEEIKKLVIAYEPIWAIGTGKT
ASSEQAQDMHAAIRKHLSSKYGEAVAEEISILYGGSCKPSNAKEIFSKADVDGGLIGGAS
LKSRDFVDIAESF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaaaaattgttgcaggaaactggaaaatgaactgcttacttgaagaaggtcaa
aaacttacttctgaaatagtaaacatgataaaagacgagccaattaaggacgttaaagta
atattaaatcctccttttgtacacctacatggcgttaaaaagcttatcgcaggagttgac
aatattgccctaggtgcccaaaattgctcagacaaagaggcaggtgcctataccggagag
acatcagcagctatgttggcttcatttggcgctgaatatgtcatcattggccacagtgaa
agaaggtctatgtttaatgaaagcaatgaattgttgacagaaaaaaccaagcaagcgctt
tcaaatggcttgaccccaattttctgctgtggtgaacccttggaaatcagagaagcagat
actcatgaagactatgtaaaagcacagcttaccgaaagtttatttgggtttagcgaagaa
gaaataaaaaaattagtaattgcatacgaacctatttgggccattggaactggtaaaacc
gcttcttcggagcaggcgcaagacatgcatgctgctattcgcaagcacctttcatccaaa
tatggagaagctgtagctgaagaaatttctattttatacggaggaagctgcaaacctagc
aatgcaaaggagatattctctaaagcagatgtagacggaggcttaataggcggtgcttca
ttaaaatctcgagattttgttgatattgcagaatccttttaa

DBGET integrated database retrieval system