KEGG   Cyclobacterium marinum: Cycma_1451Help
Entry
Cycma_1451        CDS       T01592                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cmr  Cyclobacterium marinum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Cycma_1451
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cycma_1451
Enzymes [BR:cmr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Cycma_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1722035..1722586
Genome map
AA seq 183 aa AA seqDB search
MEIRETPIKDVYEIYPKVFKDARGYFLESYRQDSFEKKGLNTTWVQDNQSYSEAGIVRGL
HFQKGEHAQAKLVRVISGKVLDVCVDLRKGSATYGKFHSVVLDEKLQNMLYVPKGFAHGF
AVWEDAVFTYKCSNLYNKESEGGIIWNDKQLSIDWGVDEPLLSEKDQLWPDVEKFTEISK
GGL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcagggaaacacctattaaagatgtatatgaaatctacccaaaagtatttaaa
gatgcaaggggttattttttagaaagttaccgacaagatagttttgaaaagaagggatta
aacaccacatgggtccaagacaatcaatcctattctgaagccggaattgttcgtggtctc
cactttcaaaagggcgaacatgcgcaagcaaagctagtaagggtcattagtggcaaagtc
ttggatgtttgtgtagacctaagaaaaggctcagccacctatgggaaattccattctgtg
gtccttgatgaaaaattacaaaatatgttatatgttcctaaaggttttgctcatggcttt
gccgtctgggaagatgctgtatttacttataaatgttctaacctttacaacaaagaaagt
gaaggtggaattatttggaatgataaacagttaagcattgattggggagtggatgaacca
ctactgtcagaaaaagaccagttatggcctgatgttgaaaaattcacagaaataagcaaa
ggaggactttaa

DBGET integrated database retrieval system