KEGG   Cyclobacterium marinum: Cycma_2059Help
Entry
Cycma_2059        CDS       T01592                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00010  Glycolysis / Gluconeogenesis
cmr00052  Galactose metabolism
cmr00500  Starch and sucrose metabolism
cmr00520  Amino sugar and nucleotide sugar metabolism
cmr00521  Streptomycin biosynthesis
cmr01100  Metabolic pathways
cmr01110  Biosynthesis of secondary metabolites
cmr01120  Microbial metabolism in diverse environments
cmr01130  Biosynthesis of antibiotics
cmr01200  Carbon metabolism
Module
cmr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cycma_2059
   00052 Galactose metabolism
    Cycma_2059
   00500 Starch and sucrose metabolism
    Cycma_2059
   00520 Amino sugar and nucleotide sugar metabolism
    Cycma_2059
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cycma_2059
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cycma_2059
Enzymes [BR:cmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cycma_2059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Hexokinase_2 RuvX
Motif
Other DBs
NCBI-ProteinID: AEL25806
UniProt: G0J157
Position
complement(2402500..2403348)
Genome map
AA seq 282 aa AA seqDB search
MNIGIDLGGTKIQVGIEHEGKIIHKTKALLKEKNDLQSTLNQVMQFIKPLTAHEVEGIGI
GVPSVVDVEKGIVYNVTNIPSWKKVALKDILEQEFNLPVFVNNDVNCFAIGEHKFGKGKS
YSNMVGLSIGTGLGSGIIIKNKLYAGVNCGAGEIGLLPYLNHNIEYYASGNFFSAEYQTT
ALDAFTAAKNGEKEALEQWKAFGQHFGAAVQVVMYTYDPEAIVIGGSVANAYPFFEKAMR
ESFSDFIYPESFKKLKIHLTKNEDIALLGAAALVDLPVNATN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaacataggaatagatttaggaggaacgaaaatacaggtaggtattgaacacgaagga
aaaatcattcacaagaccaaggctcttctgaaagaaaaaaatgaccttcagtctacgctt
aaccaagtgatgcaatttataaaaccactaactgcccatgaagtagagggaataggaatt
ggtgtgccgtcagtggtggatgtagaaaaagggattgtttataatgtaaccaacatccct
tcctggaaaaaggtagcattaaaagacattcttgaacaggaatttaatcttccggttttc
gtaaacaatgatgtcaactgctttgccattggagagcataaatttggtaagggtaaaagt
tacagcaatatggtaggcttgtcaatagggacaggtttaggatcaggcatcattatcaaa
aacaagctatatgcaggagtaaattgtggtgccggtgaaattggtttacttccttacctt
aaccacaatatagaatattatgccagcggaaatttcttcagtgccgaataccaaaccact
gcattagatgcctttaccgctgccaaaaatggggaaaaagaggccttggaacaatggaaa
gcctttggtcagcattttggagctgcagtgcaagtggtaatgtatacttatgatcccgaa
gcaatcgtcatcggcgggtcggtagcaaatgcctatccattttttgagaaggctatgcgt
gaaagcttcagtgactttatctatcctgaatcatttaaaaaattgaaaatccatttgaca
aaaaacgaagacattgcgcttttgggagccgctgcccttgtagacctacctgtcaatgcc
accaattaa

DBGET integrated database retrieval system