KEGG   Cyclobacterium marinum: Cycma_2314Help
Entry
Cycma_2314        CDS       T01592                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cmr  Cyclobacterium marinum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cycma_2314
Enzymes [BR:cmr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Cycma_2314
Peptidases [BR:cmr01002]
 Cysteine Peptidases
  Family C44
   Cycma_2314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2700216..2702021
Genome map
AA seq 601 aa AA seqDB search
MCGVHLLVDSSAKDDVAITKMVESCTHRGPDHAEVIRIRRGIFLASNRLKISDLRDEANQ
PISNQEQNAFLSWNGFLYNYQDLKNQLLEEGVVFKTRSDGEVLFHWLKEKGTKGIAAIEG
MFALVFVDLISSEIILARDPVGMKSLYFYQGENKLLCSSEVNCLLKAGGGKKGFDTDQIV
PFWYLRTSLPTNSFFKEIKELLPGQVLKFDLDGQNISQLKIPIHQRSGEKETVPDQTVFK
QRLTEAVLTHFTAEVPVGMILSGGADSSLLYHIWYKETGVPLPSYTIGFEMAKGKRSSDA
KYAANLTKTMGGGNQEIKIGPDYFLDTWEEYIAQLDHPVGDSASYLTWALAKEARKQVKV
LVSGVGADELFAGYNRHKAFKAYLKHPQLWQNISSLLKHVPLWSRSYQKFLKSIHTDPSR
TFINFAALNPVPEELGMSLKKIYPFAGRDFKNALAYDQNLYLVHDLLKIHDNACMAHGIE
GRAPFLDWGLIKLSDSMSEELLLSIPAKSWIKETLVKEGLETIANREKKGFGLPILEWYM
NHSAFRNKLSSSVIAFGEKYGNFVAQEWQPLFKYPEKHIQNNYLLLFNVFLLSDWINLNA
Q
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtgttcatttactggttgattcatctgcaaaagatgatgttgccataactaag
atggttgaaagctgtacccatcgaggaccggaccatgcggaggtaattaggatcagaaga
ggaatatttcttgcctccaataggttgaaaatttcggacctgagagatgaagccaatcaa
cctatatccaatcaggagcaaaacgcttttttgtcgtggaatgggtttttatacaattac
caagacttaaaaaatcaactgttggaagaaggggttgtttttaaaactcgctcagatgga
gaggttttgtttcattggttaaaagagaaagggacaaaggggattgcagcgatcgaagga
atgttcgcccttgtttttgtagatctaataagcagtgaaattattttggccagagaccct
gtggggatgaaatcgttgtatttttatcagggtgaaaataagcttttgtgctcatctgag
gtaaattgtttgttaaaggccggggggggtaaaaaaggttttgatacagatcaaattgtg
cctttttggtatttgaggacatctttaccaaccaattcattttttaaggaaattaaggag
ttattaccggggcaagtattgaagtttgatttagatggtcaaaatataagtcaattaaaa
atccctatccatcagcgatcaggggaaaaggaaacagttccggatcaaacagtatttaaa
cagcggctaaccgaagcagtccttacccatttcactgctgaagtgcctgtaggaatgatc
ttgagtggaggagctgatagttcacttttgtatcatatttggtacaaggaaacaggtgtg
ccattgccatcctataccatcgggtttgaaatggcaaagggcaagcgttcatcagatgca
aagtacgcagctaacttgaccaaaaccatgggtggtgggaatcaagaaatcaaaattggg
ccggattattttctagatacttgggaggaatatattgctcaattggatcatcccgtagga
gatagtgcgagctatttaacctgggccttagctaaagaagccagaaaacaggtaaaagta
ctggtaagtggcgtaggggctgatgagttatttgcaggctataataggcacaaagctttt
aaagcctatctaaagcaccctcaattgtggcaaaatatttcaagcttgctaaagcatgta
cccttgtggtctagaagctaccaaaagttcttaaaaagcatccatactgacccttcacga
acttttataaattttgcagcacttaatcctgttcctgaagagttgggaatgagtttaaag
aaaatttatcctttcgccggaagggattttaaaaatgcattggcctatgaccaaaacctt
tatttggtacacgatttgttgaaaattcatgacaacgcatgcatggctcacgggattgaa
ggaagagctccatttttagattggggcctaataaaattaagtgattccatgagtgaagag
ctattattgagcattccagccaaatcatggatcaaggagacattggtaaaagaaggcttg
gaaaccattgctaatagggagaaaaaagggtttggtctacccattcttgaatggtatatg
aatcattcggcttttagaaataaattgagttcatccgttatcgcttttggggaaaaatat
ggcaattttgttgctcaagaatggcaacctttgtttaaatatcctgaaaaacacattcaa
aacaattatttgcttttattcaatgtgtttttactttcagattggatcaatttaaatgct
caatga

DBGET integrated database retrieval system