KEGG   Cyclobacterium marinum: Cycma_2405Help
Entry
Cycma_2405        CDS       T01592                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cmr  Cyclobacterium marinum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cycma_2405
Enzymes [BR:cmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Cycma_2405
Exosome [BR:cmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cycma_2405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2811370..2812872
Genome map
AA seq 500 aa AA seqDB search
MNPNNQYLMAMDQGTTSSRAIIFNKEGQIVASAQKDFEQFFPKTGWVEHDPKEIWTSQAS
VATEAITKANITSSQVAAIGITNQRETTIIWDRETGEPVFNAIVWQDRRTAAFCNKLKEE
GHSDLVQSKTGLIIDAYFSGTKIKWILDNLDGAREKAQKGELCFGTVDSWLVWKMTAGKE
HITDITNASRTMLFNIHERQWDEELLELLDIPIAILPEVKSSSEVYGHTSGNLLSAKIPI
AGIAGDQQAALFGQLCTDPGMAKTTYGTGCFLVMNTGEKPVKSNNKLLTTVAWQIGDKVN
YALEGSVFIGGAGIQWLRDGLSLFQDAKDSESMASGLEDNGGVYFVPALTGMGAPYWDQE
ARGAFFGITRGTTKAHMARAGLEAIAFQVHDVLKAMEKDAGEGTKEMRVDGGATANNFLM
QFQADLNQCSIKRPEIIETTALGAAYLAGLAVGYWDDLDEIRSLWKADESFEPKQDATSM
QPTLNYWHKAVERSLNWLND
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaaataatcaatatttaatggcgatggaccagggaaccaccagttcaagggcc
ataattttcaacaaagaaggccagattgtggcctctgctcaaaaagatttcgaacaattt
tttcctaaaacaggctgggttgaacatgatccaaaggaaatatggacttcgcaagcctca
gtggccaccgaagccatcaccaaagccaatataacttcgagtcaagttgcagccataggt
atcaccaaccaaagagaaacgaccattatttgggacagagagactggagagcctgttttc
aatgccattgtatggcaggatcggagaacggctgctttttgtaataagctaaaagaagaa
ggtcattcggacttggttcaaagcaagacaggtttgataatcgatgcttatttttcaggg
acaaagattaaatggatacttgacaatctagacggcgctagggagaaagctcaaaaaggt
gagctgtgtttcggtactgtggacagctggcttgtatggaaaatgaccgccgggaaagag
cacattacagacattaccaatgccagcagaaccatgcttttcaatattcatgaaagacaa
tgggatgaggaattgctagaacttttggatataccgattgctattttgcctgaagttaaa
tcaagtagtgaagtatatgggcatacttccgggaatttattgtctgcaaaaatacctatt
gcaggcattgccggtgaccagcaagcagcgctgtttggccaactgtgtacagatccggga
atggccaagaccacctatgggaccggctgttttttggtaatgaatacgggggaaaagcct
gtgaaatccaataataaacttttgaccactgtggcttggcaaataggagacaaggtcaat
tatgctttagaaggaagcgtatttattggaggggcagggattcaatggctcagagacggg
ctttccttatttcaagatgccaaagacagtgaatcaatggcatcaggtttggaggacaat
ggcggtgtgtattttgttcccgctttaactgggatgggagcaccctattgggatcaagaa
gccagaggagcattttttggtatcaccagagggaccactaaagcacatatggccagggcc
ggattagaagccatagcatttcaagtgcatgatgtattaaaggcaatggaaaaagatgca
ggcgaaggaaccaaagaaatgcgtgtagatggtggggccactgctaataatttcttaatg
caatttcaagcagatctaaaccaatgttcgattaagaggcctgaaatcatcgaaactaca
gcgttgggtgcagcctatttagctggtcttgcggtaggctattgggatgatttggatgaa
ataagaagtttatggaaggcggatgaatcttttgaacccaaacaggatgccacaagcatg
caacctactttaaactactggcacaaagcagtagagcgttctttaaattggctaaatgat
taa

DBGET integrated database retrieval system