KEGG   Cyclobacterium marinum: Cycma_2439Help
Entry
Cycma_2439        CDS       T01592                                 

Definition
pyridoxal-5'-phosphate-dependent protein beta subunit
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cmr  Cyclobacterium marinum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cycma_2439
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cycma_2439
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cycma_2439
Enzymes [BR:cmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cycma_2439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2851330..2852421
Genome map
AA seq 363 aa AA seqDB search
MKGINKYIELLNLPNGMEPFSLGEGNTPLIKSRKIGPELGFPNLYFKLESANPSGSYKDR
FAAFALADIQANNGKLCLATSSGNTGAALAAYAAAAGIPCKIAIVDGAPEGKLKQMRAYG
ASLYVIKGFGKNKEVTEKVFAKLGEVAAENQTQLQVSAFKYSPVGMEGVQTLSFELAEDL
GKVDNVFVPTGGGGLTLAVARGFQTWKQKHSDFSLPKVHCVQPEGNDTIAGNLRKGLTEA
KAVDDATTKVSGLQVAVVIDGNETLQACKNTGGNGFLVKDEDTFACQRLLAIKEGIYAEP
AGAVALAGFMKSVTSGELDKNSNAVCIVSGSGFKDPEATENLIDKNPVRYLENYYEMDQY
FRK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggtatcaacaaatacatagaactattaaatcttccaaatggaatggagcccttt
tctttaggagaggggaatactccactgattaaatcaaggaaaattggacctgaattgggg
tttccaaacctatatttcaaactggaatcagcaaatccatcgggctcctataaagatcgc
ttcgcagcatttgcccttgcagatatccaagcaaataatggcaaactttgtttggcaacc
tcgagtggcaataccggtgcggcacttgctgcttatgctgcggctgcaggaattccttgt
aaaatagccatagtggatggagcccctgaagggaaattaaaacaaatgcgagcctatgga
gcctcattgtatgttatcaagggttttggaaaaaacaaagaggtgacagagaaggtgttt
gctaagctcggagaagtggctgctgaaaatcagacccaattacaagtgagtgctttcaag
tacagtccggtagggatggaaggggtgcaaaccctcagttttgaattggcagaagacttg
ggtaaggttgacaatgtgtttgtccctactggtggaggtggcttaactttagctgttgca
agaggttttcagacatggaagcaaaagcattcagatttcagcctgcctaaggtgcattgt
gtgcaaccggaaggtaatgacaccatagcaggaaacctgagaaaaggtttaactgaagca
aaagcggttgatgatgcgaccaccaaagtgagtggccttcaggtagctgtggtaattgat
ggtaatgaaacattacaggcctgtaaaaatacaggaggaaatggtttcctagtaaaggat
gaagatacctttgcttgccaacgattattggcgataaaggaaggcatttatgctgagccg
gcaggggcagtggccttggctggttttatgaaatcggtgacttcaggagagctggataaa
aattccaatgcagtatgtattgtatcggggagtggttttaaagaccctgaagccacagag
aatttgattgacaaaaacccggtacgttatttagagaattattatgaaatggatcaatat
tttagaaagtaa

DBGET integrated database retrieval system