KEGG   Cyclobacterium marinum: Cycma_2475Help
Entry
Cycma_2475        CDS       T01592                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cmr  Cyclobacterium marinum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cycma_2475
Enzymes [BR:cmr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cycma_2475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2894037..2894690
Genome map
AA seq 217 aa AA seqDB search
MDKNEIENIGDNHLSTNVQTPLRPDAFEKSDEEKIQNIQQYFSKIMEELGLDLNDDSLSG
TPYRFAKMYVKELFYGLNPDKKPKLSVFENKYGYKKMLVEQNITIDSSCEHHFLPITGEA
NIAYVPKEKVIGLSKINRLVDYYSHRPQVQERLSLQILKDLQYALETEDVIVVISAKHLC
VSSRGIKDKNSFTTTIEYGGCFEEEKYRNEFFKILGQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaatgagattgaaaatataggtgataatcatctttcaacaaatgtccaaacg
cctttacgcccagatgcatttgagaaatctgatgaagaaaaaattcaaaatattcagcaa
tatttctctaagataatggaagagcttggacttgatttgaatgatgacagcttatcaggt
acaccttataggtttgctaaaatgtatgtaaaagagttgttttacggcttaaatcctgat
aaaaaaccaaagctatctgtttttgagaataagtatggttataaaaaaatgcttgtagag
caaaacataaccattgactcttcctgtgaacatcattttttaccaattacaggtgaagcc
aatattgcttatgttcctaaagagaaagtaatcggcttatcgaaaataaacaggctggtg
gattattattcccatcgaccccaagttcaagaaaggctttctttgcaaatcttaaaggac
ctgcaatatgctttagagacagaagatgtaattgtggtgatttcagccaaacacctctgt
gtctcatcaagggggattaaggataaaaacagttttaccacaacgatagaatatggtggc
tgttttgaagaggaaaaatatagaaatgagtttttcaaaatattaggtcagtaa

DBGET integrated database retrieval system