KEGG   Cyclobacterium marinum: Cycma_2503Help
Entry
Cycma_2503        CDS       T01592                                 

Definition
2-oxoglutarate dehydrogenase E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cmr  Cyclobacterium marinum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cycma_2503
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cycma_2503
  Amino acid metabolism
   00310 Lysine degradation
    Cycma_2503
Enzymes [BR:cmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cycma_2503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2924093..2925655)
Genome map
AA seq 520 aa AA seqDB search
MSIVIKVPAVGESITEVTIGQWFKNDGEFVEMDEVICELESDKATFELTAESSGVLHTKA
EEGDTLEIGAVICEIDPEGKEGDSPQPAAAIETEKAPEEKTASTSEAKSTGETKEMHVPT
VGESITEVTLASWIKEDGDYVELDEIIAEVDSDKATFELPAEAAGILRHVAGEGDTLEIG
DLICKIEVMEGGAPEATEATENTTAQESKSTTSSNETYATGHASPAASKILSEKGIDPAT
VKGTGKDGRITKEDAEKAEKTKPAASAPAKPAAKSSSAETKDSPAKGDRSERREKMTSLR
RTISRRLVAVKNETAMLTTFNEVNMKPIMDLRKQYKDKFKERYEVNLGFMSFFTKAACIA
LQEWPAVNAQIDGNEIIFHDYCDISIAVSSPKGLVVPVIRNAENLSFSGIEKEVVRLAVK
ARDGKLTIDEMTGGTFTLTNGGIFGSMMSTPIINAPQAAILGMHNIVQRPMAVNGEVKIL
PMMYLALSYDHRIIDGRESVSFLVRMKELLEDPARLMLGI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagtaatcaaagtcccagcagtaggagagtccatcaccgaagtaaccattggc
caatggtttaaaaatgatggtgaatttgttgaaatggatgaagtcatttgcgaactggaa
tccgacaaggctacttttgaactaacagcagaatcttcaggagtgctacacacaaaagca
gaagaaggcgataccttagaaattggcgcagtaatttgtgagatcgatccggaaggaaaa
gagggagacagtcctcagcctgcagcagcgatagaaactgaaaaggcacctgaagaaaaa
actgcaagtacatctgaagccaaaagcaccggagaaacaaaagaaatgcatgttcctact
gtaggtgaatccatcacagaagtgactttggcttcttggataaaagaagatggagactat
gtagagttggatgaaataattgctgaagttgattccgacaaagctacttttgagttacct
gctgaagcagccggaatcctcagacatgtagccggagaaggggacacccttgaaatcgga
gacttaatttgcaaaatcgaagtaatggaaggcggggctcccgaagctactgaagcaaca
gaaaatactactgctcaagaaagcaaatcaactacttcctccaacgaaacttacgcaacg
ggtcatgcctctcctgcagcaagcaagatattgtctgaaaaaggcattgatcctgccact
gtaaaaggcacaggaaaagacggcagaattactaaagaggatgctgagaaagctgaaaaa
accaagccggcggcatctgcaccagctaaacccgcagcaaaatctagctctgcagagaca
aaagacagtcctgcgaagggagaccgttctgagcgtagagaaaaaatgacatctctaaga
agaaccatttctcgcagattggtggcagtaaaaaatgaaacagccatgttgactaccttc
aatgaagtcaatatgaagcctatcatggacctcagaaagcaatacaaagacaagtttaaa
gagcgatatgaagtaaatcttggtttcatgtcctttttcacaaaggctgcttgtatagct
ttacaagaatggccagcggtgaatgctcaaatcgatggaaatgaaattattttccatgat
tattgcgacatttccatagcagtatcttctccaaaaggattggttgttcctgtcataaga
aatgcagaaaacttatctttctcaggtattgagaaagaggtggttcgcttagcagtaaaa
gcccgtgatggcaaactaaccattgatgaaatgacaggaggtacctttacccttaccaat
ggagggatttttggatccatgatgtctacaccaattatcaatgctccccaggctgcaatc
cttggtatgcacaatattgtacaaagaccaatggccgtgaacggtgaagttaaaatcctt
cccatgatgtatttggcattgtcatatgatcataggatcattgatggaagagaatctgtg
agctttctcgttcgcatgaaagagcttcttgaagatcccgcaagattaatgctgggaatt
taa

DBGET integrated database retrieval system