KEGG   Cyclobacterium marinum: Cycma_2503Help
Entry
Cycma_2503        CDS       T01592                                 

Definition
2-oxoglutarate dehydrogenase E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cmr  Cyclobacterium marinum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cycma_2503
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cycma_2503
  Amino acid metabolism
   00310 Lysine degradation
    Cycma_2503
Enzymes [BR:cmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cycma_2503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2924093..2925655)
Genome map
AA seq 520 aa AA seqDB search
MSIVIKVPAVGESITEVTIGQWFKNDGEFVEMDEVICELESDKATFELTAESSGVLHTKA
EEGDTLEIGAVICEIDPEGKEGDSPQPAAAIETEKAPEEKTASTSEAKSTGETKEMHVPT
VGESITEVTLASWIKEDGDYVELDEIIAEVDSDKATFELPAEAAGILRHVAGEGDTLEIG
DLICKIEVMEGGAPEATEATENTTAQESKSTTSSNETYATGHASPAASKILSEKGIDPAT
VKGTGKDGRITKEDAEKAEKTKPAASAPAKPAAKSSSAETKDSPAKGDRSERREKMTSLR
RTISRRLVAVKNETAMLTTFNEVNMKPIMDLRKQYKDKFKERYEVNLGFMSFFTKAACIA
LQEWPAVNAQIDGNEIIFHDYCDISIAVSSPKGLVVPVIRNAENLSFSGIEKEVVRLAVK
ARDGKLTIDEMTGGTFTLTNGGIFGSMMSTPIINAPQAAILGMHNIVQRPMAVNGEVKIL
PMMYLALSYDHRIIDGRESVSFLVRMKELLEDPARLMLGI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagtaatcaaagtcccagcagtaggagagtccatcaccgaagtaaccattggc
caatggtttaaaaatgatggtgaatttgttgaaatggatgaagtcatttgcgaactggaa
tccgacaaggctacttttgaactaacagcagaatcttcaggagtgctacacacaaaagca
gaagaaggcgataccttagaaattggcgcagtaatttgtgagatcgatccggaaggaaaa
gagggagacagtcctcagcctgcagcagcgatagaaactgaaaaggcacctgaagaaaaa
actgcaagtacatctgaagccaaaagcaccggagaaacaaaagaaatgcatgttcctact
gtaggtgaatccatcacagaagtgactttggcttcttggataaaagaagatggagactat
gtagagttggatgaaataattgctgaagttgattccgacaaagctacttttgagttacct
gctgaagcagccggaatcctcagacatgtagccggagaaggggacacccttgaaatcgga
gacttaatttgcaaaatcgaagtaatggaaggcggggctcccgaagctactgaagcaaca
gaaaatactactgctcaagaaagcaaatcaactacttcctccaacgaaacttacgcaacg
ggtcatgcctctcctgcagcaagcaagatattgtctgaaaaaggcattgatcctgccact
gtaaaaggcacaggaaaagacggcagaattactaaagaggatgctgagaaagctgaaaaa
accaagccggcggcatctgcaccagctaaacccgcagcaaaatctagctctgcagagaca
aaagacagtcctgcgaagggagaccgttctgagcgtagagaaaaaatgacatctctaaga
agaaccatttctcgcagattggtggcagtaaaaaatgaaacagccatgttgactaccttc
aatgaagtcaatatgaagcctatcatggacctcagaaagcaatacaaagacaagtttaaa
gagcgatatgaagtaaatcttggtttcatgtcctttttcacaaaggctgcttgtatagct
ttacaagaatggccagcggtgaatgctcaaatcgatggaaatgaaattattttccatgat
tattgcgacatttccatagcagtatcttctccaaaaggattggttgttcctgtcataaga
aatgcagaaaacttatctttctcaggtattgagaaagaggtggttcgcttagcagtaaaa
gcccgtgatggcaaactaaccattgatgaaatgacaggaggtacctttacccttaccaat
ggagggatttttggatccatgatgtctacaccaattatcaatgctccccaggctgcaatc
cttggtatgcacaatattgtacaaagaccaatggccgtgaacggtgaagttaaaatcctt
cccatgatgtatttggcattgtcatatgatcataggatcattgatggaagagaatctgtg
agctttctcgttcgcatgaaagagcttcttgaagatcccgcaagattaatgctgggaatt
taa

DBGET integrated database retrieval system