KEGG   Cyclobacterium marinum: Cycma_2543Help
Entry
Cycma_2543        CDS       T01592                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
cmr  Cyclobacterium marinum
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cmr01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2973357..2974046)
Genome map
AA seq 229 aa AA seqDB search
MLKLIKTIFPVMLLLVAISFFTVSCNQKQESEKKVTPTADKKPEKQKKKNILFYGNSLTA
GYGLDEDESFPSLIQNKIDSLNLNYRVINGGLSGETTASGLSRLDWFLEDQPEVFILELG
GNDGLRGIPLAETRKNLNAIISSVSNRFPDTKILLAGMQIPPNMGQEYSEEFREMYAEIA
RKQEVEMIPFLLEGVAGNPDLNLPDGIHPTSEGQEIVAQTVWKHLRPLL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaattgataaaaacaatatttccggtaatgctacttcttgtagccatttccttt
tttactgtctcctgtaatcaaaaacaggaatcagagaaaaaggttacacctacagcagat
aaaaagcctgagaagcaaaagaaaaaaaatattttattttatggcaatagtttgacagca
ggatatggtttggatgaggatgaatcttttccttccttgattcaaaataaaatagatagt
cttaacttaaattatcgagtgataaatggtggtttaagtggagaaactactgccagtggc
ttgagtaggcttgattggtttctggaggatcaacccgaagttttcatacttgaactcgga
ggaaacgatgggttgagaggaatccctttagcagaaaccagaaaaaaccttaatgcaatc
atttcatctgtttcaaacagatttcctgacaccaaaatcttgttggccggaatgcagatt
cctcccaatatggggcaagaatattcggaagagtttagggaaatgtatgctgagattgca
aggaagcaagaggtggaaatgatcccttttttgctcgagggagtagcggggaatcctgat
ttaaatttgccggatggtattcacccgactagtgaaggtcaagagattgtcgcccaaaca
gtttggaaacatttacgaccgctactataa

DBGET integrated database retrieval system