KEGG   Cyclobacterium marinum: Cycma_2565Help
Entry
Cycma_2565        CDS       T01592                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00230  Purine metabolism
cmr01100  Metabolic pathways
Module
cmr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Cycma_2565
Enzymes [BR:cmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Cycma_2565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 AAA_19 MobB AAA_22 cobW CPT AAA_25 RsgA_GTPase ABC_tran AAA_30 TsaE AAA_17 AAA_24 AAA AAA_23
Motif
Other DBs
NCBI-ProteinID: AEL26304
UniProt: G0IW84
Position
2997701..2998273
Genome map
AA seq 190 aa AA seqDB search
MSQGKVIIFSAPSGSGKTTIVKHLLAHEPLLGFSISACTRDKRGREEENGKDYYFLTPEE
FREKINQDAFIEWEEVYAGNFYGTLKEEIKRIWDQGRHVIFDVDVKGGINLKEYFGDKAL
SIFVKVPSMEDLAQRLRDRGTETEESLSRRIYKAKFEMGFEKEFDVVLVNEDLDRSFKEA
EKLVADFIKK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaggaaaagtaattattttttcagctccttccggatctggtaaaaccactatt
gttaaacacctactagcacacgagcctttattaggcttttctatttctgcatgcacccga
gacaagaggggtagagaagaagaaaacggaaaagattattattttttgactcctgaggag
tttcgggaaaaaataaatcaagatgcttttattgaatgggaggaagtttatgccggcaac
ttttatggtacccttaaggaagaaatcaaaagaatttgggatcaaggaaggcatgttata
tttgacgtagatgtaaaaggaggcattaacctaaaagaatattttggtgacaaggccctt
tccatttttgtaaaagtaccttcaatggaggatttggcccaaaggctaagagatagaggt
acagagacagaagaaagcctgtcgagaagaatctacaaggctaagtttgaaatgggcttt
gagaaagaatttgacgtggttttggtcaacgaagatttagatcgttctttcaaggaagca
gagaaattggttgcagactttattaaaaaataa

DBGET integrated database retrieval system