KEGG   Cyclobacterium marinum: Cycma_2667Help
Entry
Cycma_2667        CDS       T01592                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cmr  Cyclobacterium marinum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cycma_2667
Enzymes [BR:cmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Cycma_2667
Exosome [BR:cmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cycma_2667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3096310..3097278)
Genome map
AA seq 322 aa AA seqDB search
MLRRPRRNRKSPAIRALVEETRLSVKDFILPLFLIEGINQKVPVKSMPGIFRYSLDQMLI
EIESCLKLGITTFDIFPAYPEDKKDRWATESHNEDTFYLKALFTIKQTFPEACIMTDVAM
DPYSIDGHDGLVDDGKILNDETLEILGKMTLAQARVGADIIGPSDMMDGRIGYLRRLLDK
NGFQDVSLMSYTAKYASAFYNPFRDALDSAPKAGDKKTYQMDPANSQEALIEGQLDFEEG
ADFLMVKPALAYLDIIKLLHDNYPLPIAAYNVSGEYAMIKASAANGWLDGERAMRESLLS
IKRAGAKIILTYFAKEFALLKK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaaggccaagaagaaatagaaaatcccctgctatacgtgccttggtggaagaa
actagactatctgtcaaagattttattctcccactatttttaattgaaggaatcaaccaa
aaagtaccagtaaaatccatgccgggtattttcaggtattccttggatcaaatgctaatt
gaaattgaaagttgcttgaaattaggtattactactttcgatattttccctgcatacccc
gaagacaaaaaggatcgctgggcaactgaaagccataatgaagatactttttacctcaag
gctctcttcactatcaagcaaacatttcctgaggcatgtataatgacggacgtagccatg
gacccttacagtatagatgggcacgacggactggttgatgatgggaaaatcttaaatgac
gaaacccttgaaattttaggaaaaatgactctggcacaagccagagtaggggctgatatc
ataggcccctcagacatgatggatggacgaatcggttatttaagaaggttgcttgacaaa
aatggctttcaagatgtttcattaatgtcttatacagcaaaatatgccagtgctttttac
aatccatttcgtgatgcactagactctgctccgaaagccggtgataaaaaaacctaccaa
atggatccggccaatagccaagaagcattaattgaggggcagttagactttgaagaaggg
gcagatttcttaatggttaagccagcattggcatacttggatattatcaaacttcttcat
gacaattaccccttaccaatagctgcttacaatgtgagcggagaatatgcgatgatcaaa
gcatctgcagcgaatggttggctagacggagaaagagccatgcgggagtcattactaagc
ataaaaagagcaggagctaaaataatacttacctatttcgctaaagaattcgcccttttg
aaaaagtaa

DBGET integrated database retrieval system