KEGG   Cyclobacterium marinum: Cycma_2828Help
Entry
Cycma_2828        CDS       T01592                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cmr  Cyclobacterium marinum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cmr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3287032..3288084
Genome map
AA seq 350 aa AA seqDB search
MIDVALLKEICELPGAPGFEKKIRDFILEKAKGLVDEIAVDNLGNVIAIKKGQRNPEGKK
VMVAAHMDEIGFIVTHIDDNGFLRFHTLGGFDPKTLTAQRVIVHGKEKDIMGVMGTKPIH
VMTQEEKNKLPKISDYFIDLGMDKEEVEKWIEVGDPITRERELVEMGNCVNCKSIDNRIA
VFILLEALRVLEAPAYDVYATFTVQEEVGIRGAQVSAHHIDPDFGIALDTTIAFDLPGAA
AHEKITELGKGTAIKIMDASAICDYRMVAFMKKTAAKNNIPFQTEILTAGGTDTAGVQRM
GRKGAIAGAISIPTRHLHQVIEMANKEDVQSSIQLLKATLEEIDSFDWAH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgttgctttattaaaagaaatttgtgaactgccgggagctcccggatttgag
aaaaaaatcagagattttatcctagaaaaagccaaaggtttagtagatgaaatagctgta
gataatttaggaaatgtcatcgcaataaagaaggggcagagaaaccctgaagggaagaag
gtaatggtggctgctcacatggatgagataggctttattgtcacccatatagatgacaat
ggatttttaaggtttcatacgcttggcggttttgatccgaaaactctcacagcccagcgg
gttatcgttcatgggaaagagaaggatatcatgggcgtgatgggtacgaagccaattcat
gtgatgactcaggaggaaaaaaacaaactgcctaaaatttcagattatttcattgatttg
ggaatggataaggaagaggttgagaagtggattgaagtaggtgatcccattacccgagaa
cgtgagttggtggagatggggaactgcgtcaactgtaaatctatcgataacagaatcgca
gtttttattttgttggaagccttaagggttttggaagctcccgcttatgatgtgtatgcc
acttttacggtgcaggaagaagttggtatacgtggtgcgcaggtttcggcacatcatatt
gatcctgatttcggaatcgccctggataccacaattgcttttgatcttccgggggcagca
gctcatgagaaaatcaccgaactgggtaaaggtactgccattaaaattatggatgcctca
gccatatgtgattatagaatggttgctttcatgaaaaagacagctgccaaaaataacatt
ccttttcaaacagaaattttaacagcaggaggaacggatactgccggagtgcagcgaatg
gggagaaaaggagccattgcaggtgccatctctatccctacaaggcatttgcaccaagtt
atagaaatggccaacaaagaagatgttcaatcaagtattcaacttcttaaggcgactctg
gaagaaatagatagttttgattgggcccattaa

DBGET integrated database retrieval system