KEGG   Cyclobacterium marinum: Cycma_3028Help
Entry
Cycma_3028        CDS       T01592                                 

Definition
(GenBank) dihydrofolate reductase region
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00670  One carbon pool by folate
cmr00790  Folate biosynthesis
cmr01100  Metabolic pathways
Module
cmr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cycma_3028
   00670 One carbon pool by folate
    Cycma_3028
Enzymes [BR:cmr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Cycma_3028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 HNH_3
Motif
Other DBs
NCBI-ProteinID: AEL26756
UniProt: G0J572
Position
complement(3541487..3541990)
Genome map
AA seq 167 aa AA seqDB search
MIISIIVAKATNNAIGLKGDLPWRLPADLKHFKKTTAGHHVIMGRKTFETLNKPLPGRTH
LVITSNHNYKVPEGHEVVHSLEEAIAIGKEKGLEKIFILGGAEIYKLALPYSQEMIITEI
EAFPEADTYFPDFDKENWVIFDKSIHHKDENNPFDFAFVTYRRKAVP
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
ttgatcatttctattatagttgcaaaggccaccaacaatgccattggcctaaaaggagac
ttgccttggcgcctacctgcagaccttaagcacttcaaaaaaactacagcaggccaccat
gttattatgggcaggaagacttttgaaactttgaataaaccactacccggcagaacacat
ttagtgattaccagtaatcacaattataaagttcctgaaggtcatgaggtggtacacagt
ttggaagaagcaattgccataggaaaagaaaaagggctagaaaaaatttttattctggga
ggtgcagaaatatacaagctggccttaccttatagtcaagaaatgatcataaccgaaatt
gaagcttttcctgaagcagatacctatttcccggattttgacaaagaaaactgggtaatt
ttcgacaaaagtattcaccacaaagatgaaaacaatccattcgattttgcgtttgtgacc
tatagaagaaaagctgttccttaa

DBGET integrated database retrieval system