KEGG   Cyclobacterium marinum: Cycma_3113Help
Entry
Cycma_3113        CDS       T01592                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cmr  Cyclobacterium marinum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cycma_3113
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cycma_3113
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cycma_3113
Enzymes [BR:cmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cycma_3113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3644994..3645767
Genome map
AA seq 257 aa AA seqDB search
MNRIDELFKNKDGNILSIYFTAGFPNLDDTVGIMEAIEEAGADIIEIGIPYSDPVADGPT
IQDSNNVALNNGMTLKLLFTQLEGLRSKLNIPVVLMGYLNPIVQYGMDAFCKKCQEVGVD
GVIIPDLPMQQYTDSYKELFDNYNLRNTFLISPQTSEKRIREIDNKTDGFIYMVSSASIT
GAKKEVTPEQIAYFERVRDMGLKNPRLIGFGISDKASFTTASTYSHGAIIGSAFINVVKE
AKSLSEEIKTFIKGVIS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaatagacgaattatttaaaaataaggatggcaatatcctttctatatacttt
acagctggcttccctaatttggacgacaccgtcggaatcatggaagccatagaggaagca
ggggcagatattattgaaataggtataccctattctgaccctgttgccgatggtcctacc
attcaagatagcaacaatgttgccttgaacaatgggatgacactgaaattgttatttact
caattggagggattaagaagcaaattaaatattcctgtggtattgatggggtatctaaat
cctattgttcaatatggaatggatgcattctgcaaaaaatgtcaggaagtaggcgttgat
ggagtgattattcctgacttgccaatgcaacaatatactgattcctataaagaattgttt
gataattataaccttagaaacactttcttaatttctcctcagacttctgaaaaaaggatt
cgagaaatcgataacaagacagatggatttatctatatggtctcatctgcaagtattaca
ggagctaaaaaagaggttactccggagcaaatagcttatttcgagagggtaagggacatg
ggactaaaaaatccacgattgatcggttttggtatctcagacaaagcttcctttacaacc
gcctcaacttattcccatggagcaattattggaagtgctttcatcaatgttgtcaaggaa
gcaaaatcccttagtgaagaaatcaaaacatttataaaaggcgtcatatcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system