KEGG   Cyclobacterium marinum: Cycma_3197Help
Entry
Cycma_3197        CDS       T01592                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cmr  Cyclobacterium marinum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cycma_3197
Enzymes [BR:cmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Cycma_3197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3752959..3753870
Genome map
AA seq 303 aa AA seqDB search
MNQGHKILVVGSANTDMVIRVEKFPAPGETLSGHNFLLNAGGKGANQAVAAARLGGKVAM
MARLGNDLFGKQTIENFKKEGLNVEGVVLDNKLPSGVAQIVVDKSGENTIVVAGGSNLAL
NTRQVNKYYSLVQEAEVILLQLEVPMETVLYVAQKATGLGKKVILNPAPANKLSDKLYAS
IYAITPNETETKFLTGINITGEKSAQHAADFFHDKGVKVVIITLGAAGAFLSTPDYSGTI
ATSEVEAVDTTAAGDTFNGALATALSNKMDWEEAVAFANKAASLSVTKHGAQASVPFLKD
LNV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagggacataaaatcctcgtggtaggaagtgcgaatacagacatggtcatcaga
gtagaaaaatttccggctccgggagaaacattatcgggacataattttttactaaatgca
ggaggaaaaggagccaatcaagccgttgccgctgcacggcttggaggcaaagttgccatg
atggctagattaggaaacgatctttttggaaaacaaaccattgagaattttaaaaaagaa
gggctgaatgtggaaggtgttgtacttgacaataaattaccttcaggtgtggctcaaatt
gtagttgacaagtctggagaaaataccatagtggtagcaggagggtctaatttggcttta
aatacaagacaggtcaataaatactatagcctagtgcaggaagccgaagtaattcttttg
cagttagaagtccctatggaaaccgttttatatgtagcacaaaaggccacaggtctggga
aagaaagtaattttgaatccggctccggctaataaactttcagataaactatatgcctca
atttatgccattaccccgaatgaaacagaaaccaaatttttgacaggtatcaatattacc
ggtgaaaaaagtgcgcaacatgcggcagattttttccatgacaaaggggttaaagtagtc
ataataaccctaggtgctgcaggtgcctttctttccacacccgattattccggtacaatt
gccacatctgaggtggaagcggtggatacgacagctgcaggggacactttcaatggtgcc
ttggccactgctttatccaacaagatggattgggaagaggcagtagcctttgccaataag
gctgcttctttgtctgtgaccaaacatggagcgcaagcctctgtaccatttttgaaagac
ctcaatgtctaa

DBGET integrated database retrieval system