KEGG   Cyclobacterium marinum: Cycma_3907Help
Entry
Cycma_3907        CDS       T01592                                 

Definition
glycoside hydrolase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cmr  Cyclobacterium marinum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cycma_3907
Enzymes [BR:cmr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cycma_3907
Exosome [BR:cmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cycma_3907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4710469..4712469
Genome map
AA seq 666 aa AA seqDB search
MKLKIVQEDPWLEDYKEEIYQRWVRFQRAYDEIKTPDKGLKEFASGHDYFGINFDKSKHA
WIYREWAPEAQALFLIGDFNNWNRTSHPLKMDEWGVWSIELPYEVYKDNFVHKSLVKVHV
ISEKGGLDRIPAYIRRVVQDENTKDFSGQLWFPEKPFVWTDKGYRPVHDKEGLLIYECHV
GMGLEEEAVGSYLDFADKILPKIRDLGYNAIQLMAVMEHPYYGSFGYHVSSFFCPSSRFG
TPEDLKYLVNKAHEIGLAVIMDVVHSHAVQNVAEGLNAFDGSDHQYFHSGPRGYHEVWDS
KLFDYGKWEVKRFLLSNLKYWLEEFHFDGFRFDGVTSMLYFHHGLTTFDHFEKYFLKDVD
WDAIIYLQLANSLIKEVKPYAISIAEDVSGMPGLCRLPAEGGVGFDYRLAMGVPDFYIKM
LKEKKDEEWDILEFWKELSDRRYKEKTIAYAESHDQALVGDKSIAFWLMDKEMYFHMRVG
DESIVIDRGIALHKLLRLFTIGLGGEGYLNFMGNEFGHPEWVDFPREGNNWSYKYARRQW
SLAEDKDLKYQFLLNWDRSMLALIKAHKVLCAPFADQVHADPANKVVIFRRGALLFAFSF
NPQVAIADYKFKAPEMGQYRLVLNSDDVQYGGFGRIDNSLAYFTDQKQQLSIYMTNRTAL
VFEKFD
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaaattgttcaagaagatccctggttagaggattacaaagaagagatttac
caaagatgggtgaggtttcaaagggcatatgatgaaattaagacgccagataaaggacta
aaagaatttgcctccggacatgattattttgggattaattttgataagtcaaaacatgca
tggatttatagggaatgggcaccggaggcccaagctttatttttaataggtgattttaat
aattggaatcgcaccagccatccccttaaaatggatgaatggggagtctggtccattgaa
ttgccatatgaagtgtataaagacaattttgtacataagagtttggtaaaggttcatgtc
atttccgaaaaaggaggcttagaccgaatacctgcttatatcagaagagtagttcaggat
gaaaatactaaagatttttccggccaattatggtttccggaaaaaccttttgtttggacg
gataaggggtatagacctgttcacgacaaagaaggcttattgatttacgagtgtcatgta
ggtatggggcttgaggaagaagctgtaggttcttacttggattttgcagataaaatattg
ccgaaaattagggacttagggtacaatgccattcaattaatggcagtaatggaacacccg
tattacggttctttcggttatcatgtttctagttttttctgtccttccagtagatttggg
acacctgaagatttgaaataccttgtcaataaagcccatgaaattgggcttgcagtgatc
atggatgttgtgcattcccatgctgtacagaatgttgctgaaggcttaaatgcatttgat
ggatcagatcaccagtattttcattcaggtcccaggggataccatgaggtatgggattct
aagttgtttgattatggaaaatgggaggtaaaaaggtttttactttccaatttaaaatat
tggttggaagaatttcattttgatggatttcgattcgatggagtaacttccatgctttat
tttcaccacggattgacaacttttgatcattttgagaagtattttttgaaagatgtagat
tgggacgcaatcatttatttgcaactggcaaatagccttattaaggaggtaaaaccatat
gccatttccattgcagaagatgtaagtggaatgcccgggctttgtaggttgcctgcagaa
ggtggagtgggttttgattataggttggccatgggtgtgcctgatttttacatcaaaatg
ctcaaagagaaaaaagacgaagaatgggatatccttgagttttggaaagagctcagtgat
cgtaggtacaaagaaaaaaccattgcctatgcagaatctcatgatcaagctttagtaggt
gataaatccattgctttttggttaatggataaggagatgtactttcacatgcgcgtgggg
gatgaaagtattgttattgatagggggatagccctacacaagttattaagacttttcact
attggactaggaggagaagggtatcttaactttatggggaatgaatttggacatcctgaa
tgggtagattttccacgagaagggaacaattggagctataagtatgcacgaagacagtgg
agtttggcagaagacaaggatcttaaatatcaatttttacttaactgggacaggtccatg
cttgcccttattaaagcgcataaggttttatgtgctccctttgccgatcaagtgcatgct
gatccggcgaataaggtagtaatctttcgaagaggggcattattgtttgctttttctttc
aacccccaggtagcaattgctgattataaatttaaagctcctgaaatggggcaatacagg
cttgtgctcaattcagatgatgtgcagtatggagggtttggccgaatagacaatagtttg
gcctattttacagaccaaaagcaacaattaagcatctatatgaccaacagaactgctttg
gtttttgaaaaattcgattga

DBGET integrated database retrieval system