KEGG   Cyclobacterium marinum: Cycma_4037Help
Entry
Cycma_4037        CDS       T01592                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
cmr  Cyclobacterium marinum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cycma_4037
   00052 Galactose metabolism
    Cycma_4037
Enzymes [BR:cmr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Cycma_4037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4885353..4886525
Genome map
AA seq 390 aa AA seqDB search
MKYLTLKALVLVGLITSCGPNNKEKAVNEQQTEPKYLTAMEDSAFEKTIEGKEVKLYHLS
NKNGMEMTVTNFGARVVELFAPDKDGNFEDVVLGYDNLEEYSNNPGGYYGAPIGRYGNRI
ANAQFSLDGKTYSLEANNGPNNLHGAPEGYHKVVWEVLEATSQKLEMKYVSPDGEAGFPG
ELTVFMNYYLTDNNEFRITYKATTDKTTIVNLTHHSFFNLNGHGEGSVRNHMLQLNADNF
TPVDDNLIPLGEIRSVESTPFDFREPHLVGERIDADNEQLKKGGGYDHNWVVNREEGSKE
TIKIATVWVPENGRKMEVFTDQPGVQVYTGNFMTGGGPSKAGKNYQKQGAICLETQHYPD
SPNQPSFPSVTLKPEETYSHECIYKFSVID
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacttaaccttaaaagccctcgtcttagtgggtctaattacctcatgtggacct
aacaataaagagaaagcggtaaacgaacaacaaacagaaccgaaatatttaacagcaatg
gaagattcagcatttgaaaaaacaattgaaggtaaggaagtgaaattgtatcacctcagc
aataagaatggaatggaaatgaccgtaaccaattttggcgcaagggtagtagaattgttt
gctccggataaggacgggaattttgaagatgtggttttgggttatgataatcttgaagag
tatagcaataatcccggaggctattatggagccccaattggtaggtatggcaatcgaata
gccaatgcacaattttcattagatggtaagacttattctctagaggccaataatggtccc
aataatcttcatggagctccggagggttatcataaagtggtttgggaagtacttgaagct
accagtcaaaagttggaaatgaaatatgtttcaccagatggagaagcagggtttccaggt
gagttaactgtttttatgaattattatttgacagataataatgaatttagaattacctat
aaagccactactgataagactaccattgtcaatttaactcatcactctttttttaatcta
aatggacatggtgaaggaagcgtgagaaaccatatgcttcagttaaatgcagataatttt
actcctgtagatgataatttaatacccttgggtgaaattagatctgttgaaagtacacca
tttgattttagagaacctcaccttgtaggggaacgcatagatgcagacaatgagcagttg
aaaaaaggaggagggtatgaccataactgggtagtaaaccgtgaagaaggtagcaaagaa
acgattaaaatcgctactgtatgggtccctgaaaatggtcggaaaatggaagtatttacc
gatcaacccggggtacaggtgtataccggcaattttatgacagggggaggcccatcaaaa
gccggaaaaaattatcaaaagcaaggagccatttgtttggaaactcagcattatcccgat
tctccaaatcagccttcctttccttcagtgacacttaagccggaagaaacttattcacat
gaatgtatatataaattttctgtgattgattga

DBGET integrated database retrieval system