KEGG   Cyclobacterium marinum: Cycma_4117Help
Entry
Cycma_4117        CDS       T01592                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cmr  Cyclobacterium marinum
Brite
Enzymes [BR:cmr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Cycma_4117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4981425..4982513
Genome map
AA seq 362 aa AA seqDB search
MLKFQSFQWLVILFAGGLFLASCDIIHDENPPDLPNTPTLIGLQVPGNFPAPVLMPDNPI
SNEGVLLGKTLFYDPGLSLDGSVSCASCHDQKLAFSDGVSLGNFGVSGKNLVRHSPTLIN
MAWMDQGLFWDGGSKNLESQAFGPLTHADEMGMSLDNLEFRLTLDPEYTALFLEAFEDGV
TFQNVAKALAQFERTLISSNSRYDKYIRNERGGELNELELKGLTIVQEKCSSCHSGELFT
DNGFHNNGMDESFLDESHELSYLGRYRITFEQKDMGAFKTPTLRNVMVSAPYMHDGRFSG
IEEVLHHYSEEIKDVSTTSRKLYQNNGKVGLALSEIEKKAIIAFLHTLTDEEFLQNPDFS
AF
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaatttcaatcctttcagtggttggtgattttattcgcaggaggcctgtttttg
gcctcctgtgatattattcacgacgaaaaccctcctgatttacctaatactcctacttta
ataggtttacaagttcccggtaattttcctgcacctgtcttaatgcctgataatccaata
agcaatgaaggcgtgctgttgggcaaaactcttttttatgatcctggcctctctttggat
ggtagtgtttcttgtgccagctgtcatgatcaaaaattagctttttcggatggggtttca
ctaggaaattttggggtttccggtaagaatctcgttaggcattctccaacattgatcaat
atggcttggatggatcaaggtttattttgggatgggggatctaaaaacctggaatcccaa
gcttttggacctttaacacatgcagatgaaatggggatgagccttgataatctggagttt
agacttactttagatcctgaatacacagcattatttttagaagcatttgaagatggagtt
acctttcaaaatgtagccaaagccttagctcaatttgaacgaaccttaatttcatccaat
tccaggtatgataaatacatccgaaatgaaaggggaggagagctcaatgaacttgagtta
aaaggattgactattgttcaagaaaaatgctcaagttgccatagtggagaattatttaca
gataatggtttccataataatggcatggatgaaagttttttagatgaatcccatgagcta
agctatctaggtaggtatagaattacatttgagcaaaaagacatgggggctttcaaaaca
ccaactttaagaaatgttatggtaagcgccccttacatgcatgatggtcgattttccgga
attgaagaagtcttgcatcattactcagaagaaataaaagatgtttcaactacgagtaga
aaattgtaccaaaacaatggtaaagtgggtttagctctttctgaaatagaaaaaaaggca
attatagcctttttacatacccttactgatgaggaatttttgcaaaaccctgacttttca
gctttctaa

DBGET integrated database retrieval system