KEGG   Cyclobacterium marinum: Cycma_4200Help
Entry
Cycma_4200        CDS       T01592                                 

Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
cmr  Cyclobacterium marinum
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Cycma_4200
   00565 Ether lipid metabolism
    Cycma_4200
   00590 Arachidonic acid metabolism
    Cycma_4200
   00591 Linoleic acid metabolism
    Cycma_4200
   00592 alpha-Linolenic acid metabolism
    Cycma_4200
Enzymes [BR:cmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Cycma_4200
    3.1.1.32  phospholipase A1
     Cycma_4200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5102297..5103109
Genome map
AA seq 270 aa AA seqDB search
MESLWKQQMDTSKYDFRTIKYLQISEEDFFSLYDAQPSFGMYKDNYFITGVPTNKEINKR
TADAKYQISISQRLTKSRLPFKTSLLLTYTQKSFWDIYENSSPFADNNYNPGITLIRPVL
SKQQLKGGIALSFEHESNGLDSIYSRSWNYASLSAVYFYNANISIQSKVWAGLLGDENKD
LYKFRGYGLLALNYRSFNDNFWGSLVLNPNNNISRVNTILELNFKPISSANQYIFLQWYN
GYGENLFDYNQYTSMLRFGLCIKPAMRNFY
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttggaatctttgtggaagcaacaaatggataccagtaaatatgattttcgtaccataaaa
taccttcaaatatcagaagaagatttttttagtttgtatgatgcccaacctagttttgga
atgtacaaagacaattattttataacaggggttccaaccaataaggaaatcaacaagcgc
accgccgatgccaaataccaaataagtattagccaacgactaacgaaatccagattgcca
tttaaaacttctttattgcttacatatacccaaaaatcattttgggacatttatgaaaac
tcttccccgtttgcagataacaattacaatccgggaataacactgattagacctgtgctg
agcaagcagcaattaaaagggggaattgccctttcatttgagcatgaatctaacggtcta
gactcgatttattcccgaagctggaattatgcttctttatcagcggtgtatttttacaat
gccaatatttctattcaaagcaaagtatgggccggattattgggcgatgaaaacaaagac
ctttataaattcaggggatatggattgttggccttaaattatcgaagttttaatgataat
ttctggggaagccttgtacttaaccccaataataatattagcagagtaaacaccattctt
gaattgaattttaaacctatttcatctgccaatcaatacatttttttgcaatggtacaat
ggttatggcgaaaatctctttgattacaaccaatacacctcaatgctaaggtttggttta
tgtatcaaaccggccatgaggaatttttattga

DBGET integrated database retrieval system