KEGG   Cyclobacterium marinum: Cycma_4378Help
Entry
Cycma_4378        CDS       T01592                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cmr  Cyclobacterium marinum
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5308472..5310811)
Genome map
AA seq 779 aa AA seqDB search
MKKLAKPLGSIQPEYDYVVIGSGYGGSISASRMARSGQSVCLFEKGKEFLPGEFPDSLLD
ASKEMNFIKGKSTSLEKNGLYEFTIGNGINVFKGCGLGGTSLVNANVSIKPEKRVMQDEM
WPLALRQDLASFEEGVNRAWEMLKPNPYPENKNGYPVLKKTEAMRKSADFMSAPFGLLDI
NVNFENKINHVGIKQPKCTNCGDCVTGCNVGAKNTTAMNYLPDAFNHGADIFTSINVRYV
KKFKSHWQVYYHPIGIGRDNFDAPLMFVRAKNVVLSAGSLGSTEILFRSAKKGLKVSQRL
GMRFTGNGDVLGFGYNNDERINGIGLGKKGTDQIANVGPCITSIIDLREREDLSSGMTLE
EGTVPGPIRSLMPKALIAFSRLVGKDTDRGIKDYFKEKLREFRSLFLGAFHGAVAHTQIY
LVMTHDDGNGVMKMDDEGKLNLSWEGVGKQEIFKKVSGEIFSATQALGGTKIPNPTWNNL
MNYDLVTVHPLGGCGMGESIESGVVDHKGQVFSGESDTALHEGLFVLDGAIIPRPVGTNP
LLTISALTERSCKLIAEEKGYDLNYDLVSPSNPVGNEFTGTGVQFTETMKGFIGIGEMED
FEKGFAKGKLENTTFEFTLTIQTEDIDAFISNEKHAGKMVGSMSAPSVCQEALSAYNGDF
NLFIQDEGDSERKRMNYTSALISPEGGNYYFEGFKDIYNDRVVDAWKDTTTLFITLYEGD
SPAGNIVGKGKLVIKVSDLLKQLRTVKAIHPKSKEEGRKAIGSFGKFFAGNVFETYFKP
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactagctaaacccctcggcagtatacaaccggaatatgactatgtggttata
ggttccggatatggaggtagtatttcagcctctagaatggcccgttccggacagtctgtt
tgcctctttgaaaaagggaaggagtttttgcccggagaatttcccgattccctattggat
gcctccaaggaaatgaatttcataaaaggaaaatcaacaagtctcgaaaaaaatggacta
tacgaatttaccataggaaatggaattaatgtatttaagggttgtggtctgggaggaact
tcattagtaaatgcaaacgtctcaattaagcctgaaaaaagggtaatgcaagatgaaatg
tggcccttagccttaaggcaagaccttgcttcctttgaggaaggcgtgaacagggcgtgg
gaaatgttaaaaccaaacccttacccggaaaataagaatggttaccctgtcctaaaaaag
acagaggccatgcggaaatccgctgattttatgtcagcacctttcgggttattggatata
aatgtaaattttgaaaataaaatcaatcatgttggcatcaagcaaccaaaatgtacaaac
tgtggagattgtgtcaccggctgtaatgtaggggcaaagaataccactgccatgaattac
cttccggatgcgtttaaccatggggcagatatttttacttccatcaatgttcgctatgtc
aaaaaatttaaatcacactggcaagtatactaccatccaatcggtataggcagagataat
tttgatgcgcccttaatgtttgtcagagcaaagaatgtggtgctgagtgccggatccttg
ggctcaacggaaattctattccgttctgccaaaaaagggttaaaggtttcccaaagattg
ggaatgagatttacaggaaatggtgacgttcttggttttggctataacaatgacgaaaga
atcaacggcataggcttaggtaaaaagggtacggatcaaatagcaaacgtaggaccttgt
attaccagtattattgacctgagggaacgtgaagatttgtcctcgggaatgacgcttgaa
gaaggaacagttcccggcccaattagaagtttaatgccaaaggcattgattgcattttct
aggttggtaggaaaagacactgacagaggaattaaagattactttaaagaaaagttaagg
gagtttagaagtctttttttgggagcttttcatggggctgttgcccatacccaaatttat
ttggtgatgacgcatgatgatggaaatggtgtcatgaaaatggatgatgaaggaaagtta
aacttaagttgggagggcgtaggtaaacaggaaatttttaagaaggtaagtggagaaata
tttagtgctacacaggcattgggaggaactaaaattccaaatcctacatggaataatctg
atgaattatgatttggtaactgtacatcctttaggagggtgtggcatgggagagagcatt
gaatccggagtagtggaccataaagggcaagtgttttccggagaaagtgataccgcctta
catgaaggtttgtttgttttagatggagcaattattcctaggccggttggtaccaatcca
cttttaacgataagcgcattgactgaaaggagttgtaaattaattgctgaggagaaaggt
tatgacttaaactatgatttagtcagtccctccaatccggttggtaatgaatttacaggg
actggggtccaatttaccgaaacaatgaaaggcttcataggtataggtgaaatggaagat
tttgaaaaaggttttgctaaaggaaaacttgaaaatacaacatttgagtttacattaacc
atacaaacagaagatattgatgcatttataagcaatgaaaagcatgcaggtaaaatggtt
ggaagtatgagtgctcctagcgtttgccaagaagccctttccgcctataatggtgatttt
aacttgtttattcaagatgaaggggatagtgaaaggaaacgaatgaattacacttcagca
ctcattagtccggaaggtggtaattattattttgaaggctttaaagacatatataatgat
agggtagtggatgcttggaaagataccactacactttttattacgctttatgaaggggat
tctcctgccggaaatattgttggcaagggcaagttggtaattaaagtttcggacctactt
aagcaacttagaactgtcaaagccattcatcccaaatctaaagaagagggaaggaaagcc
attggttcttttggtaagttttttgccggtaatgtttttgaaacctattttaaaccttag

DBGET integrated database retrieval system