KEGG   Cyclobacterium marinum: Cycma_4556Help
Entry
Cycma_4556        CDS       T01592                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cmr  Cyclobacterium marinum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cycma_4556
   01230 Biosynthesis of amino acids
    Cycma_4556
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cycma_4556
   00030 Pentose phosphate pathway
    Cycma_4556
   00051 Fructose and mannose metabolism
    Cycma_4556
   00052 Galactose metabolism
    Cycma_4556
  Energy metabolism
   00680 Methane metabolism
    Cycma_4556
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cycma_4556
Enzymes [BR:cmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cycma_4556
Protein phosphatases and associated proteins [BR:cmr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cycma_4556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5524296..5525297)
Genome map
AA seq 333 aa AA seqDB search
MKNIKQQHIAVFTSGGDSPGMNAALFGIAKKAEQSGMRLSGIRKGYEGLIDGDLVPLDTH
KLQKMAHRGGTILKTARSKRFLMLEGRQRALENLKKNDVDALIAIGGDGTFKGLLAFSEI
CDLPFIGIPGTIDNDISGTDYTLGFDSAVNTAIENIDKIQDTAESHNRVFIVEVMGRDSG
YIAIHSGLMVGADAILIPESGADFIYLLDKIKNYDSEDAFLIVISEGDEIGAELVASKIK
EINTNIDLRITRMGHVQRGGNPSALDRMLGIRLGVAAVDALLKGRKNIMVGVLNNRLHST
PFEEVVKQHQINDELQGLLELFGNEKYNERIGN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacataaaacagcaacatatagcagtatttacctcgggaggcgattccccaggg
atgaatgccgcattattcggaattgcaaaaaaagcagaacaaagtggcatgaggttaagc
ggcatccgaaaaggatatgagggtttaatagatggcgatttggttcctctggacacccat
aaattgcaaaagatggcacatcgcggaggaacaatactaaaaacggctcgaagcaaacgt
tttttaatgctagaaggaagacagcgggctttggaaaatcttaaaaaaaatgacgttgat
gcgctgatcgctataggtggcgatggcacttttaaaggtttgttggctttttcggaaata
tgtgacctcccttttataggtatccccggcaccatcgacaacgatatttccggcaccgat
tataccctcggctttgattccgcagtaaatacagctattgaaaacatcgataaaatacaa
gataccgctgaatcgcataaccgggtgttcatagtggaagtaatgggtagggattcaggg
tacatcgccattcactcaggattgatggtaggtgccgatgccatacttattcctgagagt
ggtgcagattttatttacctattggataagattaaaaattacgatagtgaagatgccttc
cttatcgtgatttccgaaggtgatgaaataggagctgaacttgttgcatccaaaataaaa
gaaatcaatacaaatatcgatttacggattacgaggatgggccacgtacagcgaggtggc
aatccttctgctttggatagaatgttgggcattcggcttggagtggcagctgtagatgca
cttttaaaaggtagaaagaacataatggttggtgttttaaacaatcgattacattctacc
ccctttgaagaagtggttaaacaacatcaaataaatgatgaattacagggacttttggaa
ctatttgggaatgaaaaatacaatgaaaggatcggcaactaa

DBGET integrated database retrieval system