KEGG   Cyclobacterium marinum: Cycma_4623Help
Entry
Cycma_4623        CDS       T01592                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cmr  Cyclobacterium marinum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Cycma_4623
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cycma_4623
Enzymes [BR:cmr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Cycma_4623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5588898..5589512
Genome map
AA seq 204 aa AA seqDB search
MKSVFLAFAISVIAFPFPMGNTRPCLSVKANNVKNYSLGSVAENNSIYDFTLNDIDGKPV
KLSTYKGKKLLIVNVASKCGYTPQYAALQDLYETYKDKITILAFPANNFGGQEPGTSADI
KSFCSENYGISFPIFEKISVKGVDKHPLYRWLSDKKLNGWNNEEPSWNFCKYFINENGEL
VKFFPSKVKPMDKEIIELIEAEDS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagttttcttagccttcgctatttcagtgattgcctttccctttccaatggga
aatacaagaccatgcctttccgtaaaagcaaacaatgtgaaaaattacagcttaggatct
gtggcggagaacaatagtatctatgattttacactaaatgatattgacggtaaacctgta
aagctttctacctataaagggaaaaaattgttgattgtaaatgtagcatctaaatgtggt
tatacccctcaatacgcagccttacaggacttgtatgaaacctataaagacaaaatcact
attttagcttttccggcaaataactttggaggccaagaacccggcacaagtgcagatatc
aaatctttctgttcagaaaattatggcatctcatttcccatatttgaaaaaatttctgtt
aaaggagtagacaaacatcctctgtacaggtggctttcagacaaaaaattaaatggttgg
aacaatgaagagccttcttggaatttttgcaaatactttatcaatgaaaatggagaattg
gtaaagttctttccttcaaaagttaagccaatggataaggagatcattgaattaattgaa
gcagaagactcttga

DBGET integrated database retrieval system