KEGG   Cyclobacterium marinum: Cycma_4648Help
Entry
Cycma_4648        CDS       T01592                                 

Definition
(RefSeq) succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cmr  Cyclobacterium marinum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cycma_4648
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cycma_4648
   00640 Propanoate metabolism
    Cycma_4648
   00660 C5-Branched dibasic acid metabolism
    Cycma_4648
Enzymes [BR:cmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cycma_4648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5620963..5622177
Genome map
AA seq 404 aa AA seqDB search
MNIHEYQAKEVLKSYGVKIQEGIVADSPEAALEAAKKLTADTGTSWYVLKAQIHAGGRGK
GEIKETGSRGVVLAKSLEDVPEKAKDILNGTLVTIQTGEEGKLVKKILVAQDVYYPGNSE
PKEYYLSILLDRATGSNIIMASTEGGVNIEEIAESTPEKIIKEWVDPMLGIQPYQARNVA
FKLGLEGNAFKEMVKFIMALYAAYDASDASQFEINPVLKTSDDQILAVDAKVNLDDNALY
RNKDLAAMRDLDEEDPFEVEAAESGLNYVKLDGNVGCMVNGAGLAMATMDMIKLSGGEPA
NFLDVGGGANAQTVEAGFRIILKDPKVKAILINVFGGIVRCDRIASGVVEAYKSIGDISV
PIIVRLQGTNAEEGAKIIDESGLKVTSAITLKEAAEKVQNVLSA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacacgaatatcaagctaaagaagtattaaaatcttacggagtcaaaattcaa
gaagggattgtcgctgatagccctgaagctgcactagaggcagccaagaagcttacagca
gacactggaacttcttggtatgtactaaaggcacaaatacatgccggaggtagaggtaaa
ggagaaattaaagaaaccggatcaagaggtgtggttttggctaaatcgttagaagatgtt
cctgaaaaagccaaagatatattgaatggtacacttgtgaccatccaaacaggtgaggaa
ggaaaattggtcaaaaaaatcctagttgcccaagatgtttactatccgggcaattccgaa
ccaaaagaatattacctttctatcctattggacagagccaccggtagcaatattatcatg
gcctctacagaaggtggagttaatattgaagagatcgccgaaagtactcctgaaaagatc
ataaaggaatgggtagatccaatgttgggcattcagccttaccaagcaagaaacgtggcc
tttaagttaggtttagaaggcaatgcattcaaagaaatggtgaaatttatcatggcttta
tatgctgcttatgatgcaagtgatgcttctcaatttgagatcaaccctgttttgaagaca
tcagatgatcaaattttggcagtagatgccaaggtaaatctagatgacaatgcactttat
agaaacaaagatcttgcagccatgagagatcttgatgaagaggatccatttgaagtagaa
gctgcagaatcaggccttaactatgtgaagcttgacggtaacgtaggttgtatggtaaat
ggagcaggattagcgatggccactatggacatgatcaaactttccggtggagagcctgct
aacttcctagacgtaggaggtggagccaatgcacaaaccgttgaagcaggttttagaatc
atccttaaagatcctaaagtaaaagctatccttattaatgtttttggaggaattgttagg
tgtgatagaattgcatcaggagtagttgaagcctataagtcaattggagacattagtgta
cctatcatcgtaagattgcaaggtacaaacgctgaagaaggtgctaaaataatcgatgaa
tccggacttaaagtaacttctgctattactttaaaagaagctgcagaaaaagtacaaaat
gtgcttagtgcttaa

DBGET integrated database retrieval system