KEGG   Cyclobacterium marinum: Cycma_4648Help
Entry
Cycma_4648        CDS       T01592                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cmr  Cyclobacterium marinum
Pathway
cmr00020  Citrate cycle (TCA cycle)
cmr00640  Propanoate metabolism
cmr00660  C5-Branched dibasic acid metabolism
cmr01100  Metabolic pathways
cmr01110  Biosynthesis of secondary metabolites
cmr01120  Microbial metabolism in diverse environments
cmr01130  Biosynthesis of antibiotics
cmr01200  Carbon metabolism
Module
cmr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cycma_4648
   00640 Propanoate metabolism
    Cycma_4648
   00660 C5-Branched dibasic acid metabolism
    Cycma_4648
Enzymes [BR:cmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cycma_4648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AEL28334
UniProt: G0J338
Position
5620963..5622177
Genome map
AA seq 404 aa AA seqDB search
MNIHEYQAKEVLKSYGVKIQEGIVADSPEAALEAAKKLTADTGTSWYVLKAQIHAGGRGK
GEIKETGSRGVVLAKSLEDVPEKAKDILNGTLVTIQTGEEGKLVKKILVAQDVYYPGNSE
PKEYYLSILLDRATGSNIIMASTEGGVNIEEIAESTPEKIIKEWVDPMLGIQPYQARNVA
FKLGLEGNAFKEMVKFIMALYAAYDASDASQFEINPVLKTSDDQILAVDAKVNLDDNALY
RNKDLAAMRDLDEEDPFEVEAAESGLNYVKLDGNVGCMVNGAGLAMATMDMIKLSGGEPA
NFLDVGGGANAQTVEAGFRIILKDPKVKAILINVFGGIVRCDRIASGVVEAYKSIGDISV
PIIVRLQGTNAEEGAKIIDESGLKVTSAITLKEAAEKVQNVLSA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacacgaatatcaagctaaagaagtattaaaatcttacggagtcaaaattcaa
gaagggattgtcgctgatagccctgaagctgcactagaggcagccaagaagcttacagca
gacactggaacttcttggtatgtactaaaggcacaaatacatgccggaggtagaggtaaa
ggagaaattaaagaaaccggatcaagaggtgtggttttggctaaatcgttagaagatgtt
cctgaaaaagccaaagatatattgaatggtacacttgtgaccatccaaacaggtgaggaa
ggaaaattggtcaaaaaaatcctagttgcccaagatgtttactatccgggcaattccgaa
ccaaaagaatattacctttctatcctattggacagagccaccggtagcaatattatcatg
gcctctacagaaggtggagttaatattgaagagatcgccgaaagtactcctgaaaagatc
ataaaggaatgggtagatccaatgttgggcattcagccttaccaagcaagaaacgtggcc
tttaagttaggtttagaaggcaatgcattcaaagaaatggtgaaatttatcatggcttta
tatgctgcttatgatgcaagtgatgcttctcaatttgagatcaaccctgttttgaagaca
tcagatgatcaaattttggcagtagatgccaaggtaaatctagatgacaatgcactttat
agaaacaaagatcttgcagccatgagagatcttgatgaagaggatccatttgaagtagaa
gctgcagaatcaggccttaactatgtgaagcttgacggtaacgtaggttgtatggtaaat
ggagcaggattagcgatggccactatggacatgatcaaactttccggtggagagcctgct
aacttcctagacgtaggaggtggagccaatgcacaaaccgttgaagcaggttttagaatc
atccttaaagatcctaaagtaaaagctatccttattaatgtttttggaggaattgttagg
tgtgatagaattgcatcaggagtagttgaagcctataagtcaattggagacattagtgta
cctatcatcgtaagattgcaaggtacaaacgctgaagaaggtgctaaaataatcgatgaa
tccggacttaaagtaacttctgctattactttaaaagaagctgcagaaaaagtacaaaat
gtgcttagtgcttaa

DBGET integrated database retrieval system