KEGG   Cyclobacterium marinum: Cycma_4699Help
Entry
Cycma_4699        CDS       T01592                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cmr  Cyclobacterium marinum
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cmr00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:cmr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5704564..5706093)
Genome map
AA seq 509 aa AA seqDB search
MSRFTIQTFVNHMNISLQIKAMSNCLFLFLLLSSTLNAQNFGEKGHPMNKSTDSREILKY
WGTTPNGEINLYESAYKILSAEKNASYADLIKNSSFKDLLIQQNREILAGPMLGQIKSNG
ASVWLRTLGPAKVEVWIEKTGEGKIYGPVFTDGKTELSAVVKIDDLKPSTSYPYKIIVNG
ITLSPSVEQIIKTLPEDNQYEEVKIAFGSCPHRWGLGNHTLLEQIQERGNQAMLFLGDIA
VQDRNDHLGMHRADYLLRDFLPAWQNFAAQTPVYASWDDHDYFDNDKAGIPEGYSEKGRN
GVREVFKHSWVNHSYGDEANQEGIFTRDRIGPFDILMTDNRYFRTGEKGSFLGPQQMNWL
KEQLLDCEGPFIVLSCGSMWSDYVSNGKDSWGVNDPEGREELFSFIEENNISGVLLISGD
RHGARGFTIPRKSDFGFYEFEAASLGARIGPPAIDPSWDTQLYGTDGQFAFGEFTYLHAE
QDPAVVFRLVGEAGNIIYEKTIHKSELTP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagatttactatccaaacctttgtaaaccatatgaatataagcctacaaataaaa
gcaatgtcaaattgtctttttctatttctccttttgtcttctactttgaatgcgcagaat
tttggtgaaaaagggcaccccatgaacaagagcacagatagccgagagattttgaaatat
tggggcacaacacctaatggtgaaataaatctttatgaatcggcttataaaattctatca
gccgaaaaaaatgcctcctatgctgatttaataaaaaattcttcatttaaagacctgcta
attcagcaaaaccgcgaaattcttgccggccccatgcttggacaaattaaatccaatggt
gcttcagtctggctaaggactttaggacctgcaaaagtagaagtgtggattgagaaaact
ggagaagggaaaatctatgggccagtatttactgatggaaaaaccgagttatcagcagtt
gtaaaaattgatgatttaaaaccttctacaagctatccttataagatcattgtaaacggt
ataaccctttcgccaagcgttgaacaaatcatcaaaaccttgccagaagacaaccaatat
gaagaggtaaaaatagcatttggttcctgtcctcaccgttggggattaggaaaccatact
ttgctggagcaaattcaagagagaggaaatcaagcgatgctgtttttaggtgatattgct
gttcaagataggaatgatcatttgggcatgcatagggctgattacttgttaagagatttt
ttgcctgcctggcaaaactttgctgcacagacccctgtttatgcttcttgggatgatcat
gactattttgataatgacaaagccgggatacctgaaggatactcagaaaagggtcgaaat
ggtgtcagggaagtattcaagcattcatgggtcaatcattcctatggggatgaagccaat
caggaggggatttttacaagagatagaataggcccatttgatatccttatgacagacaat
cggtattttaggaccggagaaaaaggctcatttttaggccctcaacagatgaattggtta
aaagaacaattattggattgtgaagggccatttattgtcctgtcctgtggatctatgtgg
agtgattatgtgtctaatggtaaagattcatggggagtaaacgacccggaaggaagggaa
gagttgtttagttttatcgaagaaaataatatcagtggtgtcttgcttatttcgggagac
agacatggagccagggggtttaccatacctagaaaatctgatttcggtttttatgaattt
gaagccgcaagtttaggggcgagaattggtccacccgccatagatccatcctgggatacc
caactctatgggactgatggacaatttgcgtttggagaatttacttaccttcatgctgaa
caagaccctgccgtagtttttcgcttggtgggagaagcaggcaatattatctatgaaaaa
accattcataaaagtgaattgacaccttga

DBGET integrated database retrieval system