KEGG   Cyclobacterium marinum: Cycma_4700Help
Entry
Cycma_4700        CDS       T01592                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cmr  Cyclobacterium marinum
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cmr00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:cmr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5706115..5707596)
Genome map
AA seq 493 aa AA seqDB search
MEVKVSKRRSFLGKFSFFLISFFVGRVKPLLAMKNLFGLPNNTGKLYFPNGFKVTEVSTT
EAVVWTRLSHNKKPKPIIHKKAKTKPKANNYYPVDFDENQPVKNMDGAIVGAKGKVRIKY
KAKGKTVVTDWYKTESINDFTAQIPLTNLKSGEHYSFELEAMPADGQVHSSVSGSFNTAS
DPTEIKSVNLTTSTCQYFWNYDDAKRGFQTYDAMAKLKPDFFVHTGDYVYYDRIGPLATN
LEKARHKWHAMDGWASIKEFYQQVPIYMLKDDHDLLKDDVYPDSSPLGDFTLENGLKVWR
ENVPLKDKPYRTFRWGKDLQVWLVEGREYRSPKEIPAAQPRTIWGEEQKNWFMETFEESD
ATFKILFSPTPVVGPDREKKRDNHANNLFEEEGNWLRGFLSDNKGVFVVNGDRHWQYYSI
DEATGLREFGAGPVSDAQSGGWSQDDKRPEHQYLRVNGGFLGIKVFRESNNPKINFTHYD
VQGSVMNQEEFEN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagtgtccaaaagaagatcctttttaggaaagtttagtttctttttaatt
tcattttttgtggggagggtgaaacccttgttggccatgaaaaatctctttggcttgcct
aataacaccggaaagttgtatttcccgaatggctttaaagtaaccgaagtatctacaact
gaggcagtcgtatggaccaggcttagtcataataaaaagcctaaaccgattattcataaa
aaggccaaaacaaagcctaaagccaacaattattacccggtagattttgatgaaaatcag
ccggtgaaaaatatggatggtgccattgttggggctaaaggaaaagttagaattaaatac
aaggcaaaggggaaaactgtagtaacagattggtataaaactgaatcgatcaatgatttt
actgcccaaatacctttgacaaatctaaaatcaggtgaacattattcctttgaattggag
gccatgccagcggatggacaggttcattcatctgtatcaggtagttttaatactgcttct
gacccaacggagattaagtcggtaaacttaaccacttccacctgccaatacttctggaat
tatgatgatgccaagcggggttttcagacctatgatgccatggcaaagttaaagccggat
tttttcgtccatacaggtgattatgtgtattatgatagaataggtcctttggctacgaat
ttagaaaaggccaggcacaagtggcatgctatggatggttgggcttctattaaggaattc
tatcaacaagtgccaatttatatgcttaaggatgatcatgatttgctaaaagatgatgta
tatccggattccagtcccttgggtgattttacattggaaaatggtttaaaggtttggaga
gaaaatgttcccttaaaagacaaaccttacaggacttttagatggggtaaagatttacag
gtgtggcttgtggaggggagggaataccgaagtcctaaagagatacctgcagcccagccc
agaacgatttggggtgaagagcaaaagaattggttcatggaaacctttgaagaatcagat
gccacttttaaaattttgttttctcccacccccgtagttggtccggatagagagaaaaaa
cgagacaaccatgccaataatctatttgaagaagaaggcaattggttaagaggatttttg
tccgataataagggggtttttgtagtcaatggagacaggcattggcagtattattctata
gatgaagcaacaggtttgagagagtttggtgcgggtcctgtatcagatgcacaatccgga
ggctggtctcaagatgataaaaggccggaacatcagtatttaagagtaaatggtggtttt
ttgggtatcaaagtgtttcgtgaatccaacaatcctaaaattaatttcacccattatgat
gtccaaggaagtgtcatgaatcaagaagaattcgagaattag

DBGET integrated database retrieval system