KEGG   Cyclobacterium marinum: Cycma_5073Help
Entry
Cycma_5073        CDS       T01592                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
cmr  Cyclobacterium marinum
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cmr00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cmr00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6182889..6184202)
Genome map
AA seq 437 aa AA seqDB search
MSDMFFPEIDKIKFEGKDSKNPLAFKYYDESRVIAGKTMKEHFRFAIAYWHSFCATGNDP
FGPGTMVHKWDQSNDPIQRAKDKMDAAFEFIGKIGAPFYCFHDIDLIDEGDSIATYEKHM
GAIVDYAKQKQKETGIKLLWGTANVFSHPRYMNGAATNPDFDVVSRAATQVKNAIDATIE
LGGENYVFWGGREGYMSLLNTDMKRETEHLAQFLTMARDYGRKQGFEGTFLIEPKPMEPT
KHQYDYDAATVIGFLRHFGLDKDFKLNLEVNHATLAGHTFQHELQVATDAGLLGSIDANR
GDYQNGWDTDQFAINLQELTEAMLVLLQGPGFTTGGVNFDAKIRRNSTDLDDLFHAHVGS
MDAFARSLVIANDIMVHSDYQTLRKNRYASFDGGKGKDFESGKLDLEALRSHAMEIGEPK
MTSGKQEMYENILNQFI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatatgttttttcctgagattgataagattaagtttgaaggaaaggattcaaaa
aatcccttggctttcaaatattacgatgagagccgggtaattgccgggaagacaatgaaa
gagcattttcgttttgcaatagcctattggcattcattctgtgccaccggaaatgatcct
tttggcccgggtacaatggttcataaatgggaccaatccaatgatccaattcaaagagct
aaagacaaaatggatgcagcctttgaatttatcggtaaaattggagctcctttttattgc
tttcatgacattgacctgatcgatgaaggagacagcattgcaacctatgaaaaacatatg
ggggcaatcgtagattatgccaagcaaaagcaaaaagagaccggaataaaactactttgg
ggaacggctaacgtatttagtcatccacggtatatgaacggagcagctaccaaccctgac
tttgatgtggtaagtagagctgcaacccaggtgaaaaatgccattgatgcaacgattgaa
cttggaggtgaaaattatgttttttggggcggtagagaaggttatatgtcattgttgaat
actgatatgaaacgtgaaactgagcacttggcccagtttttaacgatggccagagattat
ggaagaaagcagggttttgaaggtacctttcttattgaaccaaagccgatggagccaacc
aaacatcagtacgattatgatgcagctactgttattggatttcttagacattttgggtta
gacaaagactttaagctaaatttggaagtgaaccatgccacccttgcaggacataccttc
caacatgaattgcaagttgccacggatgcaggtcttttgggaagtattgatgccaataga
ggagactaccaaaatggttgggatactgaccaatttgccatcaatctacaagaattgaca
gaagccatgctggtacttttgcaaggccccggatttaccacaggtggagtgaattttgat
gcaaaaattagaagaaactctacagatttggacgatctatttcatgctcatgtaggaagt
atggatgcctttgcaaggagtttggttattgccaatgatatcatggtgcattcagattac
caaaccttaagaaagaaccgttatgcttcctttgatggaggaaaaggaaaagactttgaa
agtggaaaactagatttggaagcattaagaagccatgcaatggaaattggtgagccgaaa
atgacaagtggtaagcaagaaatgtatgaaaatatcctgaatcaatttatttaa

DBGET integrated database retrieval system