KEGG   Cyclobacterium marinum: Cycma_5088Help
Entry
Cycma_5088        CDS       T01592                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cmr  Cyclobacterium marinum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cmr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Cycma_5088
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Cycma_5088
Enzymes [BR:cmr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Cycma_5088
Lipid biosynthesis proteins [BR:cmr01004]
 Desaturase
  First
   Cycma_5088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6204273..6205025
Genome map
AA seq 250 aa AA seqDB search
MILIIFFLLHWYFSLFCQSFFLHRYAAHQMFVMNKYWEKFFYIFTWFCQGSSYLSPRAYA
ILHRMHHAYSDTPLDPHSPHHTENLFTMMWKTKKIYNEHFTFRAKPEERFIKDVPDWNRF
DKFADTMGIRIGWVLVYVLIYVLSISVFELAGTHWWMYFLLPIHFMMGPVHGAIVNWSGH
KYGYANFDNNDKSKNSLILDFLMLGELFQNNHHKLPKRVNFAVKWYEFDPTYPIVKLLHA
TGIIKLKPTN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgattctaataattttctttctattacactggtatttctctctgttttgccaaagcttt
ttcctacataggtatgctgcacatcaaatgtttgtcatgaacaaatattgggagaaattt
ttctacatttttacttggttctgccaaggcagttcctacctttctcccagagcttatgct
attcttcacaggatgcatcacgcctatagtgatacacccttagacccacatagtccacac
catactgaaaacctttttaccatgatgtggaaaactaaaaagatttacaatgaacatttt
acttttagggcaaaaccagaagaaagatttataaaagatgttccagattggaaccgtttt
gacaagtttgcagatacgatgggaatccgaattggttgggttttagtatatgtcttgatt
tatgttttaagtattagtgtttttgaactagcaggtactcactggtggatgtatttcctt
ttacctatccactttatgatggggccggttcatggtgcaatagttaattggagtggtcac
aaatacggttatgctaattttgataacaatgacaaatctaaaaattcattgattttagat
tttttaatgttgggtgaacttttccagaacaaccaccacaagcttcctaaaagggtaaat
ttcgcagtcaaatggtatgaatttgatccaacctatccaattgtaaaacttttacatgcc
acgggtataataaaattaaaacctaccaattaa

DBGET integrated database retrieval system