KEGG   Cyclobacterium marinum: Cycma_5091Help
Entry
Cycma_5091        CDS       T01592                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cmr  Cyclobacterium marinum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cmr00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6208282..6209040)
Genome map
AA seq 252 aa AA seqDB search
MEINQKLFTDIALEAAKAAGQEILKIYNSADLGVEFKADDSPLTKADLAAHQIISDFLSE
TNLPILSEEGKSIGYSERKNWEYFWMVDPLDGTKEFVKRNGEFTVNIALIHKGAPVIGVV
YAPVLDWLFWGNSEGAWKVEGANPVVVDLQKKTEEPIQTIVASRSHLSSETQEIIDQYPQ
ADVVSMGSSLKFMLLAEGKAQLYPRFAPTMEWDTAAAHGVLKALGYEIKKIDIDEPLSYN
KENLLNPWFIAS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaatcagaaattgtttacagatattgctttagaagcagcaaaagctgcagga
caagagattctaaaaatatataatagtgccgatttaggggttgaatttaaagcagatgat
tcaccacttaccaaagcggatttggctgcccatcaaataatatctgattttctttctgaa
acaaatttgccaattctatctgaagaggggaaaagtattggctatagcgagaggaaaaat
tgggaatatttttggatggttgacccattggatggcaccaaggaatttgtaaagaggaat
ggtgagtttacagtaaatatagcccttattcataaaggggcacccgtaattggggtagtt
tatgccccggttttggattggttgttttggggcaatagtgaaggggcatggaaagttgag
ggagctaatccagtggtggtcgaccttcaaaagaaaacggaagaacctatccaaactatt
gtggcctctagatctcatttaagttcggaaacccaagaaattatagatcaatatcctcag
gctgatgtggtaagtatgggctcgtctttgaaatttatgcttttagctgaaggtaaggcg
cagctttacccaaggtttgcacctaccatggaatgggatacggcggctgcccatggggtt
ttaaaggctttaggatatgaaataaaaaaaatagatattgacgaacccctgagctataat
aaagaaaatttgttaaatccttggtttattgcctcttga

DBGET integrated database retrieval system