KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_0100Help
Entry
CMS_0100          CDS       T00678                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CMS_0100
Enzymes [BR:cms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CMS_0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
121170..121760
Genome map
AA seq 196 aa AA seqDB search
MGVDRARIEAAVAELILAIGEDPAREGLATTPARVAEAYGEFFAGVGADPLRHLQETFPL
PETDAAPQPVIVTGIAFRSICEHHLLPFTGVAHLAYVPGERIVGLGRLPRVVDDLASRPQ
MQERLGEQIAEALEHGLGARGVAVILDAAHGCVTARGTRQAGSTTITIAARGSLAEPAAR
AEVLALLPAASGRDRP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtcgaccgggcgcgcatcgaggcggccgtggccgagctgatcctcgcgatcggc
gaggaccccgcccgggagggtctcgcgaccaccccggcgcgcgtggccgaggcctacggc
gagttcttcgcgggcgtcggcgcggatccgctccggcacctccaggagacgttcccgctg
cccgagacggacgcggccccgcagcccgtcatcgtgacgggcatcgcgttccgctccatc
tgcgagcaccacctgctgccgttcaccggcgtcgcccacctggcctacgtgccgggggag
cggatcgtcggcctcggccgcctgccgcgcgtggtcgacgacctcgcctcccgcccgcag
atgcaggagcggctgggcgagcagatcgccgaggcgctcgagcacggcctcggggcgcgc
ggcgtcgccgtgatcctcgacgcggcgcacggctgcgtcaccgcgcgcggcactcggcag
gccggcagcacgaccatcaccatcgcggcgcgcggatcgctcgcggagccggcggcgcgc
gccgaggtgctcgcgctgctgcccgcggcgtccgggcgggaccggccgtga

DBGET integrated database retrieval system