KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_0101Help
Entry
CMS_0101          CDS       T00678                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CMS_0101
Enzymes [BR:cms01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CMS_0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
121757..122632
Genome map
AA seq 291 aa AA seqDB search
MTTTPPVARTLVMGILNATPDSFSDGGRHLALDDALAHARRMVAAGADLVDVGGESTRPG
AARVDAAEERARVVPVVRELAAEGIAVSVDTMRAATAEACVAVGARIVNDVSGGLADPGM
AAVVAGADVDYVAMHWRGHSDMMAARATYADTVGEVRDELLARIDALVAAGLDPARVILD
PGLGFAKDAAHDWQLLGSLDALTGLGHRVLVGASRKRFLGRLLPEGAGVEDRDVPTAVVS
ALSARAGAWAVRVHDVASTRAAIGVEAAWARGRAEALDAASAGWSAAGLSE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgactccgcccgtcgcgcgcacgctcgtgatggggatcctcaacgccacgccc
gactcgttcagcgacggcggacgccacctcgccctcgacgacgcgctcgcgcacgcccga
cggatggtcgctgcgggcgcggacctcgtcgacgtgggcggggagtccacccgtccgggt
gccgcgcgcgtcgacgcagcggaggagcgggcgcgcgtcgtgcccgtggtccgcgagctc
gccgcggaggggatcgccgtgagcgtcgacaccatgcgcgccgcgaccgcggaggcctgc
gtcgccgtcggggcgcggatcgtcaacgacgtgtccggcggtctcgcggatccgggcatg
gccgcggtcgtcgccggcgccgacgtcgactacgtggcgatgcactggcgcggccacagc
gacatgatggccgcgcgcgcgacgtacgccgacaccgtgggcgaggtgcgcgacgagctg
ctcgcgcgcatcgacgcgctcgtggccgcggggctggatcccgcccgcgtcatcctcgac
cctggtctcggcttcgcgaaggacgccgcgcacgactggcagctgctcggatccctcgac
gcgctcacgggcctcggccaccgcgtgctcgtgggcgcgtcccgcaagcgcttcctcgga
cggctgctgccggagggtgcgggcgtcgaggaccgcgacgtgccgaccgcggtcgtcagc
gcgctctccgcacgagcgggggcgtgggccgtgcgcgtgcacgacgtcgcgtccacccgc
gccgcgatcggggtcgaggcggcgtgggcgcgcggccgggccgaggcgctcgacgccgca
tccgccgggtggtccgccgccggtctgtcagagtag

DBGET integrated database retrieval system