KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_0201Help
Entry
CMS_0201          CDS       T00678                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CMS_0201
Enzymes [BR:cms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CMS_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
241359..242171
Genome map
AA seq 270 aa AA seqDB search
MVLGSLNVDQVVRVPRHPQPGETLMGSDPERLWGGKGANQAVAAADAGGEVAMVGAVGDD
ADGSAYRARLTARGIDVTGLATVDGATTGLAIIAVDDDGENTIIVAPGANGRVTSTHLDP
LDALAAGDVLLASLELPLDTISEGVRRAHAAGARVVLNLAPFAALPADVLALADPVVVNE
HEAGLLRGSGTPAPASLLVTLGAEGAMWGDVEVPASKVSRVVDTTGAGDAFCGALASALA
AGADRGAALVVAADAAAVVVQRQGAQPADD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtggtgctcggatcgctcaacgtcgaccaggtggtgcgcgtgccgcggcacccgcagccg
ggggagacgctcatgggatccgaccccgagcggctctggggcggcaagggcgcgaaccag
gcggtcgcggcggccgacgccggcggcgaggtcgcgatggtgggggccgtgggcgacgac
gccgacggatccgcctaccgcgcgcgtctgacggcccgcggcatcgacgtcaccggcctg
gcgacggtggacggcgcgacgacgggcctcgcgatcatcgcggtggacgacgacggcgag
aacacgatcatcgtcgcgcccggcgccaacgggcgcgtgacatctacgcacctggatccg
ctcgacgcgctcgccgcgggcgacgtcctgctcgcctcgctcgagctccccctcgacacg
atctccgagggcgtccgccgcgcgcacgccgccggcgcccgcgtcgtgctcaacctcgcg
cccttcgccgcgctgcccgccgacgtgctggcgctcgcggatcccgtcgtcgtcaacgag
cacgaggcgggactcctccgcgggtcgggcacaccggcccccgcgtcgctgctcgtgacc
ctcggcgccgagggcgcgatgtggggcgacgtcgaggtccccgcgtcgaaggtctcccgc
gtcgtcgacaccacgggcgccggcgacgcgttctgcggcgcgctggcctcggcgctcgcc
gcgggcgccgaccgcggggccgccctggtcgtcgccgccgacgcggccgcggtcgtggtg
cagcggcagggcgcgcagccggcggacgactga

DBGET integrated database retrieval system