KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_0747Help
Entry
CMS_0747          CDS       T00678                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cms00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CMS_0747
Enzymes [BR:cms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CMS_0747
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CMS_0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
795672..796607
Genome map
AA seq 311 aa AA seqDB search
MPELPEVEVVRAGLEPAVAGARITGVEILDARSLKRHDPLEGAFVDLLVGRVITSAVRRG
KFMWLPLEPEPTGDRTGPRALVTHLGMSGQVLLREPGSDPDGLLRIRMGIEHPAHGELVV
AFVDQRIFGSMAVDRLVATPDGHAGGRGSTAALVPTQVAHIARDPLDPAFDDEQLLSRLA
RRRTGIKRALLDQTLVSGIGNIYADEALWAARIHYAHPTDQLGRGRALRLLAEVRHVLAR
ALAEGGTSFDAQYVNVNGASGYFSHSLNAYGQQGKPCPRCGTPIVREAFMNRGSHFCPRC
QALPDPDAAAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagctccccgaggtcgaggtcgtccgcgccggcctcgagcccgcggttgctggt
gcgcgcatcacgggcgtcgagatcctcgacgcgcgctccctcaagcggcacgacccgctc
gagggcgcgttcgtcgacctgctcgtcggccgcgtgatcacctcggccgtccgccgcggc
aagttcatgtggctgccgctcgagcccgaaccgacgggtgaccgcaccggcccgcgcgcc
ctcgtcacccacctcggcatgagcgggcaggtgctgctccgcgagcccggctccgacccc
gacggcctgctgcggatccgcatgggcatcgagcaccccgcgcacggcgagctcgtcgtc
gcgttcgtcgaccagcggatcttcggctcgatggccgtcgaccgcctcgtcgcgacaccc
gacgggcacgcgggcggacggggatcgaccgccgcgctggtgccgacgcaggtcgcccac
atcgcgcgcgaccccctcgacccggccttcgacgacgagcagctgctgtcgcgcctcgcc
cggcggcgcacggggatcaagcgcgcgctcctcgaccagacgctcgtcagcggcatcggc
aacatctacgccgacgaggcgctgtgggccgcgcgaatccactacgcgcaccccaccgac
cagctgggtcgcggtcgcgcgctgcggctcctcgccgaggtgcgccatgtgctcgcgcgg
gcgctggccgagggcggcacgagcttcgacgcgcagtacgtcaacgtcaacggcgcgtcc
ggctacttctcgcactcgctgaacgcctacgggcagcagggcaagccctgcccgcgctgc
ggcacgcccatcgtgcgcgaggccttcatgaaccgcggctcgcacttctgcccgcgctgc
caggcgctgccggatccggacgccgcggcggcctga

DBGET integrated database retrieval system