KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_0891Help
Entry
CMS_0891          CDS       T00678                                 

Gene name
rafA
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cms00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cms00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cms00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(932087..934270)
Genome map
AA seq 727 aa AA seqDB search
MPDTAVPSALLHLRASGVSLVLDLTEGRLPAVVHWGADLGDTTPADLETMVRADLAPFAG
SVADDPIRLAILPEAHTSWTGKPGLEGHRDGADWSPLFRVTSATVDGDPLPVGVDGRPGS
ASTGPALVHVDAVDEVAGLGLALDVELLASGLVRKRAEATNLGDTTYDLGGVTLALPLPP
EAREILDFAGRWGLERTPQRRELVVGIHEREGRKGRTGPDAATLLSVGTPGFGFRHGDVR
GVHVAFSGNHRHYAERLSTGRQVIGGGELLLPGEVRLAAGESYASPWVYAAFGHGLDDQA
ARFHRHLRARETHPRRDRPMTINVWEAVYFDHDLARLTDLADRAAALGVERYVLDDGWFR
HRRDDHAGLGDWYLDEGVWPDGLGPIIDHVTGLGMEFGLWFEPEMVNEDSDLARAYPEWI
MQTGGRLPVRARQQQVLDLAIPEAYSYVLERMTAILAENDIAYIKWDHNRDLVDAGISPR
GQAGVHLQTLAAYRLMDELRARFPGLEIESCSSGGARVDLGVLERTDRVWVSDCIDPLDR
QTMMRWTMQLLPPELLGSHIASGVSHTTGRAHRLAFRAGSALYGHLGIEWDLAQATDEEN
ADLAAWIALYKEERALMHTGTVVRADESDPTLLVYGAVASSSDAALFFLASVGRSEVSPR
GRFLLPGLDPARRYRVEPVRVDTPEPGFTAPAWWDGVELTGQALAASGLHAPGMLPESIA
ILRVTAV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacaccgccgtcccctccgccctcctccacctccgggcatccggcgtctcgctc
gtgctcgacctcacggagggccgcctcccggccgtcgtgcactggggcgccgacctcggc
gacaccaccccggccgacctcgagaccatggtgcgcgcggacctcgcgccgttcgcgggc
agcgtcgccgacgatcccatccgcctcgcgatcctgcccgaggcgcacacctcgtggacg
ggcaagcccggcctcgagggccaccgcgacggcgccgactggtcgccgctcttccgcgtc
acctcggccaccgtcgacggcgatccgctccccgtcggcgtcgacgggcgcccgggatcc
gcgtccaccggccccgcgctcgtgcacgtcgacgcggtcgacgaggtcgcggggctcggc
ctcgctctcgacgtcgagctgctggcgtccggcctcgtccgcaagcgcgcggaggccacg
aacctcggcgacacgacctatgacctcggcggcgtcacgctcgcgctgccgctgccgccc
gaggcccgcgagatcctcgacttcgccggacgctggggcctcgagcgcacgccgcagcgc
cgggagctggtggtggggatccacgagcgcgagggccgcaagggccgcaccggacccgac
gccgcgaccctgctgtccgtcggcacgcccggcttcggcttccgccacggcgacgtgcgc
ggcgtgcacgtcgcgttcagcggcaaccaccggcactacgccgagcgcctctccaccggc
cggcaggtgatcggcggcggcgagctgctgctccccggcgaggtgcggctggccgcgggc
gagtcgtacgcgagcccgtgggtctacgcggcgttcggccacggcctcgacgaccaggcc
gcccgcttccaccgccacctgcgcgcccgcgagacgcacccgcgccgcgaccggcccatg
accatcaacgtgtgggaggccgtctacttcgaccacgacctcgcgcgcctgaccgacctc
gcggatcgcgcggcggccctcggcgtggagcgctacgtgctcgacgacggctggttccgc
caccgccgcgacgaccacgcgggcctcggcgactggtacctcgacgagggcgtctggccc
gacggcctcggcccgatcatcgaccacgtcacgggcctcggcatggagttcggcctgtgg
ttcgagcccgagatggtgaacgaggactccgacctcgcgcgcgcttaccccgagtggatc
atgcagaccggcggccgcctccccgtgcgcgcccgccagcagcaggtgctcgacctcgcg
atccccgaggcgtactcctacgtgctcgagcggatgaccgcgatcctcgccgagaacgac
atcgcctacatcaagtgggaccacaaccgcgacctcgtcgacgccggcatctccccgcgc
ggccaggcgggcgtgcacctgcagacgctcgcggcgtaccgcctcatggacgagctgcgg
gcgcgcttccccggcctcgagatcgagtcgtgctcctccggcggagcccgcgtcgacctc
ggcgtgctcgagcgcaccgaccgcgtgtgggtctccgactgcatcgaccccctcgaccgc
cagacgatgatgcgctggaccatgcagctcctcccgcccgagctcctcggctcccacatc
gcgtccggcgtcagccacaccaccggccgcgcgcaccgcctcgccttccgcgcgggctcg
gcgctgtacggccacctcggcatcgagtgggacctcgcgcaggccaccgacgaggagaac
gccgacctcgccgcgtggatcgccctctacaaggaggagcgcgcgctgatgcacacgggc
acggtcgtccgcgccgacgagagcgacccgacgctcctcgtctacggcgcggtcgcgtcg
tcgtccgacgcggcgctgttcttcctcgcgtcggtcggccgctccgaggtctccccgcgc
ggccgcttcctgctgccgggcctcgatcccgcgcgccgctaccgcgtggagcccgtgcgc
gtggacacccccgaaccgggcttcaccgcgcccgcctggtgggacggcgtcgagctgacg
ggccaggcgctcgcggcctccggcctgcacgccccggggatgctgcccgagtcgatcgcg
atcctgcgggtgacggcggtctga

DBGET integrated database retrieval system