KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_1107Help
Entry
CMS_1107          CDS       T00678                                 

Definition
protease
Orthology
K01354  
oligopeptidase B [EC:3.4.21.83]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1159991..1162156)
Genome map
AA seq 721 aa AA seqDB search
MTDPAVPAVSSPASDSSATPPVAEQRPIERTFHGDTFVDRYEWLRDKDDADVIAHLEAEN
AYTDQATAHLEPLREQLFTEIKDRTQETDLSVPVREGDWWYYARTVEGSQYAIRCRRPVA
GPDDWTPPVIEPAADGTATPGEQVLLDSNAEADGHEFFSLGAFEVSPDGSLLAYSVDVEG
DERFLLKIRDLTTGEDLADEIPGTSHGATFSAHGDHLFYVTVDDAWRPDTVWRHRVGSPA
SQDVKVFTEPDESYFVGFGMTRSRQYLVIEVGSKITTEVLLLDAGDPTGAFRSVWPRRHG
VEYDVDHAVIDGSDRLLILHNDGATNFELIDVPADDPTSTTDRQVVIPHDDEVRLEDASA
FADHLVISYRREGLTRVGVIPFDRVLDGEQLHEIAFDEPIYTVGTAGNPEFAQPTVRLGY
TSLATPATTYDYVLATRELRLLKQQPVRGGYDPDDYVQTREWATAEDGTEIPLSVIYKRG
LVHPGTPAPLLLYGYGSYEASIDPSFSIARLSLLDRGMAFVIAHVRGGGEMGRRWYDEGK
TLTKKNTFTDFVAAADHLIARGWTSPEKLVAEGRSAGGLLMGAVANIAPDRFAGILAGVP
FVDALTSILDPSLPLTVIEWDEWGDPLHDPEVYAYMKSYTPYENVREGVEYPRILAVTSL
NDTRVLYVEPAKWTTRLREVGAPVLLRTEMQAGHGGKSGRYDAWRERASDYAWVLDVAGL
A
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccccgccgtcccggccgtctcctcccccgcatccgactcctccgccacccct
cccgtcgcggagcagcgccccatcgagcgcaccttccacggcgacacgttcgtggaccgc
tacgagtggctgcgcgacaaggacgacgccgacgtcatcgcgcacctcgaggccgagaac
gcgtacacggatcaggccaccgcgcatctggagccgttgcgcgagcagctgttcacggag
atcaaggaccgcacgcaggagaccgacctctccgtccccgtccgcgagggcgactggtgg
tactacgcgcgcacggtcgaggggtcgcagtacgcgatccgctgccgccgccccgtcgcc
ggcccggacgactggaccccgcccgtcatcgagcccgccgccgacggcacggccaccccc
ggcgagcaggtgctgctcgactccaacgccgaggccgacggccacgagttcttctcgctc
ggcgcgttcgaggtcagccccgacggatcgctcctcgcctactccgtcgacgtcgagggc
gacgagcgcttcctgctcaagatccgggacctcacgacgggcgaggacctcgccgacgag
atccccggcaccagccacggcgccaccttctcggcccacggcgaccacctcttctacgtc
acggtggatgacgcgtggcgccccgacaccgtgtggcgccaccgcgtcggcagccccgcg
tcgcaggacgtgaaggtgttcaccgagcccgacgagagctacttcgtcggcttcggcatg
acgcgcagccgccagtacctcgtcatcgaggtcggctcgaagatcacgaccgaggtgctc
ctgctcgacgccggggatcccacgggcgcgttccgctcggtgtggccgcgccggcacggg
gtcgagtacgacgtcgaccacgcggtcatcgacggatccgaccggctcctcatcctgcac
aacgacggcgccaccaacttcgagctgatcgacgtgccggccgacgacccgacgtccacg
accgaccggcaggtcgtcatcccccacgacgacgaggtccgcctcgaggacgccagcgcg
ttcgccgaccacctcgtgatctcctaccgccgcgagggcctcacgcgcgtcggggtgatc
cccttcgaccgcgtcctcgacggcgagcagctgcacgagatcgcgttcgacgagccgatc
tacacggtcggaacagcgggcaaccccgagttcgcgcagcccaccgtccgcctcggctac
acgagcctcgcgacgccggccaccacctatgactacgtgctcgcgacgcgcgagctgcgc
ctcctcaagcagcagcccgtgcgcggcggctacgacccggacgactacgtgcagacccgc
gagtgggcgaccgcggaggacggcacggagatcccgctctcggtgatctacaagcgcggc
ctcgtgcacccgggcacgccggcgccgctcctgctctacggctacggctcctacgaggcg
agcatcgacccatcgttctccatcgcgcggctgtcgctgctcgaccggggcatggcgttc
gtcatcgcgcacgtgcgcggcggcggcgagatgggccggcgctggtacgacgagggcaag
acgctcaccaagaagaacaccttcaccgacttcgtggcggcggccgaccacctcatcgcg
cgcgggtggaccagcccggagaagctcgtcgccgagggccgcagcgccggcgggctcctg
atgggcgcggtcgcgaatatcgcgcccgaccggttcgccgggatcctcgcgggcgtgccg
ttcgtggacgcgctgacgagcatcctcgacccgtcgctgccgctcaccgtgatcgagtgg
gacgagtggggcgacccgctgcacgaccccgaggtgtacgcgtacatgaagtcgtacacg
ccgtacgagaacgtgcgggagggcgtggagtacccgcggatcctcgcggtcacgagcctc
aacgacacgcgcgtgctctacgtcgagcccgccaagtggacgacccgcctccgcgaggtc
ggcgcgcccgtgctgctgcgcaccgagatgcaggccggccacggcggcaagtcgggccgc
tacgacgcgtggcgcgagcgcgcctccgactacgcgtgggtgctcgacgtggcggggctg
gcctag

DBGET integrated database retrieval system