KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_1150Help
Entry
CMS_1150          CDS       T00678                                 

Definition
glycosyl transferase
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Metabolic pathways
Brite
Enzymes [BR:cms01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     CMS_1150
Glycosyltransferases [BR:cms01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   CMS_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1204054..1204800
Genome map
AA seq 248 aa AA seqDB search
MSSLTIVIPTYEEARNVGELLPRLAAMAGQNPDFRITAMIVDDSSPDGTADLVRSLAPSV
ETDTFRVRVETRAEKAGLGAAYIWAFEKLLGADEPPTHILQMDADLSHDPAYITEMLRRV
RGGADLVVASRYIRGGATPDWDLKRRFLSVGGNLYTRLFLGSRITDYTGGFNLYETQLLR
RIRPSTITTTGYGFQIEMKQRALKTAKRPTEVAIVFMDRTEGESKIPSDTLVKNLLLVLQ
LRFGLRRG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgagcagtctcacgatcgtgatccccacctacgaggaggcgcgcaacgtcggggagctg
ctgccccgcctcgcggccatggcgggccagaaccccgacttccggatcacggccatgatc
gtcgacgactcctcgcccgacggcaccgccgaccttgtccggtcgctcgcgccgagcgtc
gagaccgacacgttccgcgtgcgcgtcgagacccgcgcggagaaggccggcctcggcgcg
gcctacatctgggccttcgagaagctgctcggggccgacgagccgccgacccacatcctg
cagatggacgccgacctctcgcacgaccccgcctacatcacggagatgctgcgccgggtg
cgcggcggcgccgacctcgtggtcgcctcgcgctacatccggggcggcgcgacgcccgac
tgggacctcaagcgccggttcctcagcgtcggcggcaacctctacacgcgcctgttcctc
ggctcccgcatcacggactacacgggcggcttcaacctctacgagacgcagctgctgcgg
cggatcaggccctccaccatcacgaccacgggctacggcttccagatcgagatgaagcag
cgcgcgctgaagaccgcgaagcgtcccaccgaggtggcgatcgtgttcatggaccgcacc
gagggcgagtcgaagatcccgagcgacacgctcgtgaagaacctgctgctcgttctgcag
ctgcgcttcgggctgcgccggggctga

DBGET integrated database retrieval system