KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_1355Help
Entry
CMS_1355          CDS       T00678                                 

Definition
ROK family regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CMS_1355
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMS_1355
   00052 Galactose metabolism
    CMS_1355
   00500 Starch and sucrose metabolism
    CMS_1355
   00520 Amino sugar and nucleotide sugar metabolism
    CMS_1355
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CMS_1355
   00524 Butirosin and neomycin biosynthesis
    CMS_1355
Enzymes [BR:cms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CMS_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1420674..1421639
Genome map
AA seq 321 aa AA seqDB search
MHAIGIDIGGTKIAGAVVDELGVIAAEERTPTEAGSPDAIVEAVVGMVEWLRAQHPDVVA
VGVAAAGFIDAAQSTVYYAPNINWRNEPVREKLRGRIDLPIVIENDANAAGWAEFRYGAG
RLVSDMVTLTIGTGVGGAIVADDRLFRGGFGAGAELGHMRVVPDGLPCGCGARGCIEQYG
SGRALLRTADELADLGGTHGEGLAARRREVGALTGHDVSDLIQAGDPGALLALRRLGGWL
GEAAASIGAILDPQMFVIGGGVAQAGDLLLDPIREAYLAHLPARGYHPEPEFRIAELVND
AGVVGAADLARLHAAALTHGA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgcaatagggatcgacatcggcgggacgaagatcgcgggagccgtggtcgacgag
ctcggcgtcatcgcggcggaggagcgcacgcccaccgaggcgggtagcccggacgcgata
gtcgaggccgtcgtcggcatggtcgagtggctccgcgcccagcacccggacgtcgtcgcg
gtcggcgtggcggcggccggcttcatcgacgccgcgcagtccaccgtctactacgccccg
aacatcaactggcgcaacgagccggtgcgcgagaagctgcgcggccggatcgacctcccc
atcgtcatcgagaacgacgcgaacgccgccggctgggccgagttccgctacggcgcgggc
cggctggtcagcgacatggtcacccttaccatcggcacgggcgtgggcggcgcgatcgtc
gccgacgaccggctcttccgcggcggcttcggcgcgggcgccgagctcggccacatgcgg
gtggtgccggacggcctgccctgcgggtgcggcgcccgcggctgcatcgagcagtacgga
tccggtcgcgcgctcctgcgcaccgccgacgagctggccgacctcggcggcacgcacggc
gagggcctcgccgcccgccgtcgcgaggtgggcgcgctcaccggacacgacgtcagcgac
ctcatccaggccggcgatcccggcgcgctcctcgccctccgccgcctcggcggctggctc
ggcgaggcggccgcgagcatcggcgcgatcctcgacccgcagatgttcgtcatcggcggc
ggcgtcgcgcaggcgggcgacctcctgctcgacccgatccgcgaggcgtacctcgcccac
ctcccggcccgcggctaccacccggagcccgagttccggatcgccgagctcgtcaacgac
gccggcgtcgtgggcgccgcagacctcgcccgcctgcacgccgccgcgctcacccacgga
gcctga

DBGET integrated database retrieval system