KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_1478Help
Entry
CMS_1478          CDS       T00678                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CMS_1478 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CMS_1478 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CMS_1478 (thrC)
Enzymes [BR:cms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CMS_1478 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1550586..1551662
Genome map
AA seq 358 aa AA seqDB search
MAHQWRGLLREYADRLDVTDATPIITLGEGGTPLIPAPALSARTGAKVWVKYEGMNPTGS
FKDRGMTMAISKAVEHGAKAVICASTGNTSASAAAYATHAGITAAVLVPEGKIAMGKLSQ
AVAHDAQLLQVRGNFDDCLDIARELSANYPVHLVNSVNNDRIEGQKTGAFEVVEVLGDAP
DFHLIPVGNAGNYTAYTRGYREDLEAGNATKLPRMFGFQAAGSAPIVDGAIVKDPDTIAS
AIRIGNPASWKLALEAQLLTDGYFGAVSDAKILEAHRILSAEVGIFVEPASAISVAGLLE
RAEAGQIPKGATVVLTVTGHGLKDPQWALRTADGSDVAPTSVGTDVAEIAGVLDLVAS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccaatggcgcggactgctccgcgaatacgccgaccgcctcgacgtcacggac
gccaccccgatcatcaccctcggtgagggcggcacgccgctcatccccgcgccggcgctc
tccgcccgcacgggcgcgaaggtgtgggtcaagtacgagggcatgaacccgaccgggtcc
ttcaaggaccgcggcatgacgatggccatctcgaaggccgtcgagcacggcgcgaaggcg
gtgatctgcgcgtcgaccggcaacacgtcggcctcggccgcggcgtacgcgacgcacgcg
ggcatcacggccgccgtgctcgtgcccgagggcaagatcgcgatgggcaagctcagccag
gccgtcgcccacgacgcccagctgctccaggtgcgcggcaacttcgacgactgccttgac
atcgcgcgcgagctcagcgccaactacccggtgcacctcgtcaacagcgtcaacaacgac
cgcatcgagggccagaagacgggcgccttcgaggtcgtcgaggtgctgggcgacgcgccg
gacttccacctcatccccgtcggcaacgcgggcaactacaccgcgtacacgcgcggctac
cgcgaggacctcgaggcgggcaacgccacgaagctgccgcgcatgttcggcttccaggcc
gccggcagcgcgcccatcgtcgacggggccatcgtgaaggaccccgacacgatcgccagc
gcgatccgcatcggcaaccccgcctcgtggaagctcgccctcgaggcgcagctgctcacc
gacggctacttcggcgcggtctcggacgccaagatcctcgaggcgcatcgcatcctgtcg
gccgaggtcggcatcttcgtcgagcccgcgtcggccatcagcgtcgccgggctcctcgag
cgcgccgaggccgggcagatcccgaagggcgcgacggtcgtcctcacggtcacgggccac
ggcctcaaggacccgcagtgggcgctccgcaccgcggacggatccgacgtcgcccccacg
agcgtgggcaccgacgtggcggagatcgcaggcgtgctcgacctggtcgcgtcgtga

DBGET integrated database retrieval system