KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_1624Help
Entry
CMS_1624          CDS       T00678                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CMS_1624 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CMS_1624 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CMS_1624 (sucB)
Enzymes [BR:cms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CMS_1624 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1708107..1709555)
Genome map
AA seq 482 aa AA seqDB search
MSESVNLPALGESVTEGTVTRWLKNVGDHVEVDEPLLEVSTDKVDTEIPSPVAGVIEEIL
VQEDETVEVGAVLVRIGDGSGGGDAPAEEPAAEQAAEPEPAADEAVEDTVIPSTEAEDDA
EAPAPVEPEPAPAAEQPDPEPTPAPAPAAPAPVAATPAPAPAAAAPAPAAAPAPAASGNA
GYVTPLVRKLANERGVDVSSVVGTGVGGRIRKEDVLAAAEAAASKSAPTASAPAAPAAAP
LETSPLRGTTAKMSRMRKLIADRAVVSMQSTAQLTSVVEVDVTKVARFRDRVKGDFLEKT
GVKLSFLPFFALAAAEALKAYPVVNATVDGDSIVYPDHENISIAVDTERGLLTPVVKNAE
GKNLAQFASEIADLAARTRDNKLSPDELAGGTFTLTNTGSRGALFDTPVVFLPQSAILGT
GIVTKRPVVITADGQDTIAIRSTVYLALSYDHRIVDGADASRFLVAVKNRLEAGAFDADL
GI
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatccgtcaacctccccgcactcggcgagagcgtcaccgagggcacggtgacc
cgctggctcaagaacgtcggcgaccacgtcgaggtcgacgagcccctgctcgaggtgtcg
accgacaaggtcgacaccgagatcccgtcgccggtcgccggcgtgatcgaggagatcctc
gtccaggaggacgagaccgtcgaggtcggcgctgtactggtccggatcggcgacggttcc
ggtgggggcgacgctcccgcggaggagccggccgccgagcaggccgctgagcccgagccg
gcggccgacgaggccgtcgaggacaccgtgatcccctccaccgaggcggaggacgatgcc
gaggcccccgcgcccgtcgagcccgagccggctcccgccgccgagcagcccgaccctgag
ccgaccccggctcccgcgcccgccgctcccgcacccgtggccgcgacccccgctccggca
cctgctgcagcagctcccgcgcccgccgccgctccggctcccgccgcctccggcaacgcg
ggctacgtgacgccgctcgtccgcaagctcgccaacgagcgcggcgtcgacgtcagctcc
gtcgtcggcacgggcgtgggaggacgcatccgcaaggaggacgtgctcgccgcagcggaa
gccgccgcctcgaagagcgccccgacggcatcggctcccgccgctcccgccgccgccccg
ctcgagacgtcgcccctccgcgggaccaccgcgaagatgtcgcgcatgcgcaagctcatc
gccgaccgcgcggtcgtgtcgatgcagtccaccgcgcagctgacctcggtggtcgaggtc
gacgtcacgaaggtggcccgcttccgcgatcgcgtgaagggggacttcctcgagaagacc
ggcgtcaagctctcgttcctgcccttcttcgccctcgccgccgcggaggcgctcaaggcc
tacccggtcgtgaacgcgacggtcgacggcgacagcatcgtctaccccgaccacgagaac
atcagcatcgcggtcgacaccgagcgcggtctcctcacccccgtcgtgaagaacgccgag
ggcaagaacctggcgcagttcgcgtcggagatcgccgacctcgccgcccgcacgcgcgac
aacaagctgtcgccggatgagctggccggcggcaccttcacgctgacgaacaccggttcg
cgtggcgcgctgttcgacacccccgtggtgttcctcccgcagtccgcgatcctcggcacc
ggcatcgtcaccaagcgccccgtggtgatcaccgcggacgggcaggacaccatcgccatc
cgctccaccgtctacctggcgctgtcctacgaccaccgcatcgtcgacggggccgacgcg
tcccgcttcctggtcgccgtgaagaaccgcctcgaggcgggcgcgttcgacgccgacctc
ggcatctga

DBGET integrated database retrieval system