KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_1830Help
Entry
CMS_1830          CDS       T00678                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CMS_1830
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMS_1830
   00052 Galactose metabolism
    CMS_1830
   00500 Starch and sucrose metabolism
    CMS_1830
   00520 Amino sugar and nucleotide sugar metabolism
    CMS_1830
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CMS_1830
   00524 Butirosin and neomycin biosynthesis
    CMS_1830
Enzymes [BR:cms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CMS_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1935206..1936312
Genome map
AA seq 368 aa AA seqDB search
MPTAGRVSEFHTGDTVICVEATRTTDGGPRVPRTARPPPVSWTPVDGRIRDRDRTKMPRT
LALAIDFGGTKVESALVDDAGRVLEGSRFRGPTGPERSADELLDAVLGVARQALAALPDD
AELVGTGLAAAGPVDVPHGLVSPLNVPAWRDYPLRDRVAELTPGVPTTLQMDGLAITLAE
HWVGAGRGHDHMMGMIVSTGIGGGLVLGGRTAAGSTGNAGHIGHVEVAGFDDPCTCGGQG
CVEAIASGPKSVAWARAQGWTGSTGEDLAASYRDGDETAVAAVRRAGLAIGRAIASASSL
VDLDVVAIGGGFSRVTPDLFDMIREPIALRQQFGFVTKTRVVPSGLSADGPIIGAGALVH
RREMVPSF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgccggtcgggtcagtgaattccacacaggtgacacggtgatctgcgtcgag
gcgacgcggaccacggacggcgggccgcgcgtcccgcggacggcccgcccaccgcccgta
tcctggacgccggtcgacgggcggatccgggaccgggacaggacgaagatgcctcgcacg
ctcgcgctcgccatcgacttcggcggcaccaaggtcgagtccgcgctcgtggacgatgcg
ggccgcgtgctcgagggcagccgcttccgcgggccgacggggccggagcgatccgccgac
gagctgctcgacgccgtcctcggggtggcccggcaggcgctcgccgccctgcccgacgac
gcggagctcgtcggcacgggcctcgcggcagccggccccgtcgacgtgccgcacggcctc
gtctcgccgctcaacgtgcccgcgtggcgcgactacccgctgcgcgaccgcgtcgccgag
ctcacgcccggcgtgcccaccaccctgcagatggacggcctcgcgatcacgctcgccgag
cactgggtcggcgccggccggggccacgaccacatgatgggcatgatcgtctccacgggc
atcggcggcgggctcgtgctgggcggccgcaccgccgcgggatccacgggcaacgccggc
cacatcggccacgtcgaggtcgccgggttcgacgacccgtgcacctgcggcgggcagggc
tgcgtggaggcgatcgcgtcgggaccgaagagcgtcgcgtgggcgcgcgcgcaggggtgg
acgggatccaccggcgaggacctcgcggcctcctaccgcgacggcgacgagacggccgtg
gctgcggtacggcgcgcgggcctcgcaatcggccgcgccatcgcgtcggccagctcgctc
gtcgacctcgacgtcgtcgcgatcggcggcggcttcagccgcgtcacgcccgacctcttc
gacatgatccgcgagcccatcgccctccgccagcagttcggcttcgtgaccaagacgcgc
gtcgtgccctccggcctctcggcggacgggccgatcatcggcgcgggcgcgctcgtgcac
cgccgggagatggtcccgagcttctga

DBGET integrated database retrieval system