KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_1853Help
Entry
CMS_1853          CDS       T00678                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cms00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1961965..1963047)
Genome map
AA seq 360 aa AA seqDB search
MRRVIVLGSTGSIGVQALEVVARHPELFEVVGLGAGTQREALAEQARAAGVEHTALGADE
AEQLIRSVDADVVLNGITGSVGLGPTLAALEEGRTLALANKESLIVGGELVRGLAAPGQL
VPVDSEHSAIAQALRGGTAEEVRRLVVTASGGPFRGRSRAELEHVTPREALAHPTWDMGL
VITTNSSTLVNKGLEVIEAHLLFDVPYERIDVVVHPQSLVHSMVEFIDGSTLAQASPPDM
RLPIALGLNWPHRMHDVGVPIDWTRAATWTFEPLDDEAFPAVLLAKQVGTAGSTYPAVYN
AANEQAVQAFHAGRAGFLDIVDTIRRVVDAHEPASGPLTRESLAEAERWTRAEADRVLGV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcgtcatcgtcctcggatccacgggctccatcggcgtgcaggccctcgaggtc
gtcgcgcggcacccggagctcttcgaggtggtggggctcggcgccggcacccagcgcgag
gcgctcgccgagcaggcgcgcgccgcgggcgtcgagcacacggccctcggcgccgacgag
gcggagcagctcatccgctcggtcgacgccgacgtcgtgctcaacggcatcaccggatcc
gtggggctcggtcccacgctcgccgcgctggaggagggccgcaccctcgccctcgccaac
aaggagtcgctcatcgtcggcggtgagctggtccgcggtctcgcggcgcccgggcagctg
gtccccgtcgactcggagcactccgccatcgcgcaggcgctccgcggggggacggccgag
gaggtcaggcgcctcgtcgtcacggcgtccggcggtcccttccgcggtcgctcgcgcgcc
gagctggagcacgtgaccccgcgcgaggcgctcgcgcaccccacgtgggacatgggcctc
gtcatcaccacgaactcgtcgacgctcgtcaacaagggcctcgaggtcatcgaggcgcac
ctgctgttcgacgtgccctacgagcgcatcgacgtcgtcgtgcacccgcagtcgctcgtg
cactccatggtggagttcatcgacgggtcgacgctcgcccaggcgtccccgccggacatg
cgcctccccatcgccctcggcctgaactggccgcaccgcatgcacgacgtcggcgtgccc
atcgactggacccgcgccgcgacgtggaccttcgaaccgctcgacgacgaggcgttccct
gccgtgctgctcgccaagcaggtcggcacggccggatccacgtacccggccgtctacaac
gcggcgaacgagcaggccgtgcaggcgttccacgcgggtcgggcgggcttcctcgacatc
gtggacaccatccgtcgcgtcgtcgacgcccacgagccggcgtctggccccctcacgcgc
gagtcgctggccgaggcggagcgctggacgcgcgccgaggccgaccgggtgctcggggtc
tga

DBGET integrated database retrieval system