KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_2008Help
Entry
CMS_2008          CDS       T00678                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CMS_2008 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CMS_2008 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CMS_2008 (trpA)
Enzymes [BR:cms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CMS_2008 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2131599..2132417)
Genome map
AA seq 272 aa AA seqDB search
MTAAAHAAAPAGSPVERTIALRREQGSGALVGYLPVGFPDVATSIEAAVALVENGVDVIE
LGLPYSDPVMDGPVIQRATQTALAQGFRLRDGFDALHAITQRVDAPVLLMTYWNPVVQYG
VERFADDIVAAGGAGLITPDLIPDEGADWLAASERTGLDRVFLAAPSSSGARLHQAVERS
RGFVYAVSTMGITGARQDVDQAARGLVSRLRDAGSTSACVGIGISTGDQVREVLDYADGA
IVGSALVAALADGGVPGVARAAADLARGTALQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcggcagcccacgcggccgcgcccgccggcagccccgtcgagcggaccatcgcc
ctccgacgcgagcagggatccggcgcgctcgtcggctacctccccgtcgggttcccggac
gtcgccacgagcatcgaggccgcggtggccctggtcgagaacggcgtcgacgtcatcgag
ctgggcctgccctacagcgaccccgtgatggacggcccggtcatccagcgtgccacgcag
accgctctcgcgcagggcttccgcctccgtgacggcttcgacgcgctgcacgcgatcacc
cagcgcgtcgacgcccccgtgctcctcatgacctactggaaccccgtcgtgcagtacggc
gtcgagcgcttcgcggacgacatcgtcgccgcgggcggcgccggcctcatcacgcccgac
ctcatccccgacgagggtgccgactggctcgccgcatccgagcgcacgggcctcgaccgc
gtgttcctcgccgccccgtcgtcgagcggggcgcgcctgcaccaggccgtggagcgcagc
cgcgggttcgtctacgcggtctccaccatgggcatcacgggcgcgaggcaggacgtcgac
caggccgcgcgcggtctcgtgtcgcgcctgcgcgatgcgggctccacgagcgcgtgcgtg
ggcatcggcatctccaccggcgaccaggtgcgcgaggtgctcgactacgccgacggcgcc
atcgtcggctcggccctcgtcgcggccctcgccgacggcggcgtgccgggcgtcgcccgt
gccgcggccgatctcgcgcggggaaccgcgctacagtag

DBGET integrated database retrieval system