KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_2009Help
Entry
CMS_2009          CDS       T00678                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CMS_2009 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CMS_2009 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CMS_2009 (trpB)
Enzymes [BR:cms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CMS_2009 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2132414..2133628)
Genome map
AA seq 404 aa AA seqDB search
MTDLRSVTGPYFGEFGGRYVPESLVAALDELSAAWEELKVDPAFVEELKELHRTYTGRPS
LITEVPRFAEHAGGARIILKREDLNHTGSHKINNVLGQALLTKKIGKKRIIAETGAGQHG
VATATAAALFGLDCVIYMGEVDTERQALNVARMRLLGAEVIPVRSGSRTLKDAINDAMRD
WVTNVETTNYVFGTVAGPHPFPAMVRDLQKVIGEEAREQVLALTGRLPDAVAACVGGGSN
AIGIFHAFLDDADVALYGFEAGGDGADTPRTAATITKGRPGMLHGARSYLLQDEDGQTID
SHSISAGLDYPGVGPEHSWLSDLGRASYRPVTDDQAMSALRLLSRTEGIIPAIESAHALA
GALELGKELGPDAIILINLSGRGDKDMETAGKYFDLIDAGAEQS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgcgcagcgtgaccggcccctacttcggcgagttcggcgggcgctacgtc
ccggagtccctcgtcgccgccctcgacgagctgtcggcggcgtgggaggagctcaaggtc
gaccccgcgttcgtcgaggagctcaaggagctgcaccgcacgtacaccggccgtccctcg
ctcatcacggaggtgccgcggttcgccgagcacgccggcggcgcgcgcatcatcctcaag
cgcgaggacctgaaccacaccggctcgcacaagatcaacaacgtgctcggccaggcgctg
ctcaccaagaagatcggcaagaagcgcatcatcgcggagacgggcgcgggccagcacggc
gtcgcgaccgccaccgcggccgcgctcttcggcctcgactgcgtcatctacatgggcgag
gtcgacaccgagcgccaggcgctgaacgtggcccggatgcgcctgctcggcgctgaggtc
atcccggtccgctcgggctcccgcacgctcaaggacgccatcaacgacgccatgcgcgac
tgggtcaccaacgtcgagaccaccaactacgtcttcggcacggtggcgggcccgcacccg
ttcccggccatggtccgcgacctgcagaaggtcatcggcgaggaggcgcgcgagcaggtc
ctcgcgctcaccgggcgcctgcccgacgccgtcgccgcgtgcgtcggcggcgggtccaac
gccatcggcatcttccacgccttcctcgacgacgccgacgtggccctctacggcttcgag
gccggcggcgacggcgcggacaccccgcgcaccgccgccaccatcaccaagggccggccc
ggcatgctgcacggcgcgcgcagctacctcctccaggacgaggacggtcagaccatcgac
tcgcactcgatctccgccggcctcgactacccgggcgtcggcccggagcactcctggctg
tcggacctcgggcgcgcgtcgtaccgtcccgtcacggacgaccaggcgatgagcgcgctg
cgcctgctcagccgcaccgagggcatcatcccggccatcgagtccgcgcacgccctggcc
ggtgcgctcgagctcggcaaggagctgggtccggatgcgatcatcctgatcaacctcagc
ggccgcggcgacaaggacatggagaccgcggggaagtacttcgacctcatcgacgccggg
gcggagcagtcgtga

DBGET integrated database retrieval system