KEGG   Clavibacter michiganensis subsp. sepedonicus: CMS_2050Help
Entry
CMS_2050          CDS       T00678                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cms  Clavibacter michiganensis subsp. sepedonicus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cms00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cms00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2173020..2174390)
Genome map
AA seq 456 aa AA seqDB search
MNSLVSDAKNAGERVGLMSDSIVINGGIPLRGRIEVRGAKNLATKAMVASLLGESPSLLR
SVPDISDVRVVSGLLEVHGVTLRKGEKEGDLILDPKDVESAHMADIDAHAGSSRIPILFC
GPLLHRLGEAFIPDLGGCRIGDRPIDFHLDALRAFGAVVEKLPSGIRLTAPNGLKGANVE
LPYPSVGATEQVLLTGVRAQGITELKNAAIEPEIMDLIAILQKMGAIISVEPNRVILIEG
VDRLEGYTHRALFDRNEAASWASAALATGGDIFVGGVRQAEMMTFLNVFRKVGGAFDIEE
DGIRFYHPGGDLKPVVIETDVHPGFMTDWQQPLVVALTQAPGVSIIHETVYENRFGFTDA
LNEMGADIVVHKEGLEGHERRVARRDFEQAAVITGPTHLHGADITVPDLRGGFSHLIAAL
TAEGRSTVSNVGIISRGYEDFIGKLRQLGADFSYEG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaactcactagtcagcgacgccaagaacgcgggggagcgggtgggcctcatgtccgac
tccatcgtcatcaacggcggcatcccgctgcgcggccgcatcgaggtccgtggggccaag
aacctggccaccaaggccatggtcgcctcgctcctcggcgagagccccagcctccttcgc
tcggtgccggacatcagcgacgtccgcgtcgtctcgggcctgctcgaggtgcacggcgtc
acgctccgcaagggcgagaaggagggcgacctcatcctcgacccgaaggacgtcgagagc
gcccacatggcggacatcgacgcgcacgcgggcagctcccgcatcccgatcctcttctgc
ggcccgctgctgcaccggctcggcgaggcgttcatccccgacctcggcggctgccgcatc
ggcgaccgccccatcgacttccacctcgacgcgctgcgcgcgttcggcgccgtcgtcgag
aagctcccgagcggcatccgcctcacggccccgaacgggctgaagggcgccaacgtcgag
ctgccctacccgagcgtcggcgcgaccgagcaggtgctgctcacgggcgtgcgcgcccag
ggcatcacggagctgaagaacgcggccatcgagcccgagatcatggacctcatcgcgatc
ctgcagaagatgggcgcgatcatctccgtggagccgaaccgcgtgatcctcatcgagggc
gtcgaccgcctcgagggctacacgcaccgcgcgctcttcgaccgcaacgaggccgcgagc
tgggcctcggccgcgctcgcgaccggcggcgacatcttcgtcggcggcgtgcgccaggct
gagatgatgacgttcctcaacgtgttccggaaggtcggcggcgcgttcgacatcgaggag
gacggcatccggttctaccacccgggaggcgacctcaagcccgtggtcatcgagaccgac
gtgcaccccggattcatgacggactggcagcagccgctcgtcgtggcgctcacgcaggcg
cccggcgtctcgatcatccacgagaccgtgtacgagaaccgcttcgggttcacggacgcg
ctcaacgaaatgggcgccgacatcgtcgtgcacaaggaggggctcgagggccacgagcgc
cgcgtcgcgcgacgcgacttcgagcaggccgcggtcatcacgggacccacccacctgcac
ggcgcggacatcacggtgcccgacctgcgcggcgggttcagccacctcatcgcggcgctc
acggccgagggccggtccaccgtcagcaacgtggggatcatctcccgcggctacgaggac
ttcatcgggaagctgcgccagctgggcgcggacttctcctacgagggatag

DBGET integrated database retrieval system